KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325779
Entry
4325779           CDS       T01015                                 
Name
(RefSeq) nodal modulator 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Motif
Pfam: CarboxypepD_reg SdrD_B EMC7_beta-sandw CarbopepD_reg_2 SpaA bMG3 DUF1416 MetallophosN
Other DBs
NCBI-GeneID: 4325779
NCBI-ProteinID: XP_015620661
UniProt: A2ZS73
Position
1:complement(11025439..11038923)
AA seq 1193 aa
MDPRLLLALLCLAAFSAAAYASDEIHGCGGFVEASSGLAKSRKASDSKLDYSDITVELCT
IDGLVKESTQCAPNGYYFIPVYDKGSFMVRVKGPKGWSWKPETVPVVIDQNGCNGNADIN
FQFTGFMISGKVVGAVGGKSCSKHGGPSGVKVELSTNSDELVASALTSSTGEYSFANIIP
GRYKLRASHPNYEIETRGSSEVDLRFGNAVADDVFFLSGYNIYGSVVAQGNPILGVHLYL
YSNDVTEVPCPQSISDAPREGALCHAVSGADGKFTFSSLPCGSYELLPYYKGENTVFDVS
PPSLLVSVEHSHMTIPQKFQVTGFSVGGRVVDGYGAGVEGANVIVDGQLRAVTDNLGYYR
LDQVTSKKYTIVAEKDHYKFNRLENFMILPNMASIDDITSVRYDVCGIVRTVTPNSKSMV
TLTHGPENVKPQRKLVSENGRFCFEVLAGEYRLSALPVDTEGSSSLMFSPGFIDVNVNSP
LLDIEFSQSQVNLHGKVLCKEQCNQNILLSLVRLAGGIEQEKKTVTLEQDNVNFAFKKIF
PGKYRLEVKHSSSEAAAQDDWCWDQNAMDINVGSDDVTDIVFVQKGYWVELVSTHETKAY
IQHPDSSKLDLLIKKGSQRICIETPGQHELHLINSCISFGSSPVVFDTKNPMPVHISAKK
YLVRGELHVEMGSLQEIDLSKNIGVDVFKSDGSFIEKISATPVLGKSYQNDISAFEYSIW
AEFGEDFIFVPRDDSTGRKNILFYPSSQQFSVAVNGCQYTVPSITAKTGLYLEGSVSPAI
SDVDIKILAAGKSKYASLKERDIAMETKTNSEGSFFAGPLYDDIGYTVEASKAGYHLKQT
GPYTFSCQKLGQILVRIYGEQDAELLPSVLLSLSGEEGYRNNSISGSGGTFSFGNLFPGS
FYLRPLLKEYKFTPSAVAIDLNSGESREVEFRATRVAYSAMGSVTLLTGQPKEGVFVEAR
SESRGYYEEATTDSFGRFRLRGLVPGSIYSVRVVAKDDHRFAAVERASPEYVSIDVGQDD
ISGIDFVVFERPESTILSGHVEGDDLDMLQPQLSVEIRSAADPSRIESVLPVPLSYYFEV
QNLPKGKHLVQLRSGLPSHTHRFESEIVEVDLDKQPQIHVGPLKYKTEERHHKQELTPAP
VFPLIVGVSVIALVISMPRLKDLYQSAVGMTTLGSAAAPIKKEPRKTIMRKRA
NT seq 3582 nt   +upstreamnt  +downstreamnt
atggatccccgcctccttctcgccctcctctgcctcgccgccttctccgccgccgcgtat
gcctccgacgagatccacggctgcggcggcttcgtcgaggcgagctcggggctagccaag
tcgaggaaggcgtcggactccaagctcgactactccgacatcacggttgagctgtgtact
attgatggtttggttaaggaaagcactcagtgtgcccctaatggatactattttatccca
gtctatgacaagggttcattcatggtcagagttaaggggcccaaggggtggtcttggaag
cctgaaactgttcctgttgtcatcgatcaaaatggatgtaatggcaatgcagatataaat
tttcagttcactgggtttatgatatctggtaaagtagtgggagctgttggtgggaagagc
tgctctaaacatggaggaccttctggtgtcaaagttgagctatcgacaaactctgatgag
ttagttgcttctgctttaacatcatctacaggagaatattcatttgcaaatataattcca
gggcgctataaattgcgtgcttctcatcctaactatgaaattgagacaaggggttcatca
gaggtggacttgcgatttggaaatgctgttgcagatgatgtcttctttctatctggatat
aatatttatggctctgtagttgcacagggaaatccaatcttgggagttcacctttattta
tattcaaatgacgtaacagaggtgccttgtccacaaagtattagtgatgcacccagagaa
ggtgctctttgccatgcagtatctggtgctgatggaaagttcacgtttagttcgttacct
tgtggtagctatgagctgttgccgtactacaaaggggaaaatactgtttttgatgtctct
cccccttcactgcttgtttctgttgagcacagtcatatgactatcccccaaaagttccag
gttactgggttttctgttggagggcgtgttgttgatgggtatggtgctggtgtggaaggt
gctaatgttatcgtggatggtcagttgagagctgtaacagacaatcttgggtattacaga
cttgatcaggttacctccaagaagtatactattgtggctgagaaggatcattacaaattc
aaccgtttggagaatttcatgattttgccaaacatggctagtattgatgatatcacatca
gttcggtatgatgtatgcggtattgttcgaacagtaaccccaaattccaaatcaatggtg
actttaacacatgggcctgaaaatgtaaagccacagaggaaactggtgagcgaaaatgga
agattttgctttgaggttcttgccggtgaataccgcttatctgccctacctgtagatacc
gaaggttcttccagtcttatgttttcaccaggatttattgatgtcaatgtcaacagtcca
ttgcttgatatagagttctctcagtcacaagtcaaccttcatggtaaggtcctgtgcaaa
gagcaatgcaaccaaaatattctgctgtcacttgttagattagctgggggaatcgagcag
gaaaagaagacagttactttggagcaagataatgttaattttgcattcaaaaaaatattt
cctgggaagtatcgtctagaggtgaagcattcatcatctgaggccgctgcacaggatgat
tggtgctgggaccaaaatgcaatggatataaatgttggttctgatgatgtgacggacatt
gtgtttgtacagaagggctattgggtagagctagtctcaactcatgagaccaaagcatac
attcaacatccagattcttctaaacttgatttgctgataaagaaaggatcacaaaggatc
tgcatagaaactcctgggcaacatgagcttcatttaattaattcctgcatttcctttggg
agctcgccagtggtatttgatacaaagaatccaatgcctgttcatatcagtgcaaagaaa
tatcttgtaagaggtgaactccatgtggagatgggctcccttcaagaaattgatttatcc
aaaaatattggtgttgatgtcttcaagagtgatgggagtttcatcgaaaaaatctctgct
acacctgttcttggaaagagttaccaaaatgacattagtgcctttgagtactccatttgg
gctgaatttggggaggacttcatttttgttccccgtgatgatagcactggaaggaaaaat
atcctcttttatccatcaagtcagcagttttcggtggctgtgaatggatgccaatacact
gttccttcaataaccgctaaaacaggtctataccttgaaggatcagtgtcgcctgcaatt
tctgatgttgacatcaagatcctagcagcagggaagagcaagtatgcatctctgaaggaa
agggacatagcaatggagacaaagacaaattctgagggatcattctttgcaggtcccctg
tatgatgatattggatatacggtggaagcttcaaaggctggctatcatctaaagcaaact
ggcccgtacaccttttcttgtcagaagcttggtcagatattggtacggatttatggtgaa
caagatgccgagcttttaccttctgtattgctgtctttgagtggtgaagaaggctacaga
aataattctattagtggttctggtggaactttcagctttggtaacttatttccaggaagt
ttctatctccgacctcttctcaaggaatataaattcactccatcagcagttgctattgat
ctcaattctggtgagtctagagaggttgaattccgtgcaactcgtgttgcctacagtgcc
atgggttctgtaaccctgctgactggccaaccaaaagagggagtatttgttgaagcaaga
tctgaatcaagaggttattatgaggaagctactactgattcttttggtaggtttcgcctt
agaggactcgtccctggctcaatttattctgtaagagtggttgcaaaagatgatcacagg
tttgcagcagttgagcgtgcttcacctgaatatgtgtcaattgatgttggtcaggatgac
atctctggtattgattttgttgtttttgaaagaccggaatcaacaattttgagtggccat
gtggaaggagatgatcttgacatgttgcaaccacaactgtctgttgaaattagatcagct
gcagacccttctagaatagaatctgtactccctgttcctctctcgtactacttcgaagta
cagaatttgccaaaaggaaagcatcttgttcagcttcgttctggtcttccatcacatacc
catagatttgagtcagagatagttgaagttgacttggacaagcaacctcagattcatgtt
ggtcctcttaaatataaaaccgaagagcgacatcacaaacaggaattaactccagcccct
gtatttcctcttattgtcggagtttccgtgattgcattggtcatcagcatgccaaggcta
aaagacttgtaccaaagtgctgtgggaatgactaccctaggttctgcggctgcgccgata
aaaaaggagccaagaaagacaatcatgagaaagagggcgtga

DBGET integrated database retrieval system