KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326375Help
Entry
4326375           CDS       T01015                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member C4
  KO
K12355  coniferyl-aldehyde dehydrogenase [EC:1.2.1.68]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4326375
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.68  coniferyl-aldehyde dehydrogenase
     4326375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 4326375
NCBI-ProteinID: XP_015618943
UniProt: Q9LRE9
Position
1
AA seq 502 aa AA seqDB search
MAAANGGDSKGFEVPKLEIKFTKLFINGRFVDAVSGKTFETRDPRTGEVIAKIAEGDKAD
IDLAVKAAREAFDHGPWPRMSGFARGRILHKFADLVEQHVEELAALDTVDAGKLFAMGKL
VDIPGGANLLRYYAGAADKVHGETLKMARPCHGYTLKEPVGVVGHIVPWNYPTTMFFFKA
SPALAAGCTMVVKPAEQTPLSALFYAHLAKLAGVPDGVLNVVPGFGPTAGAAISSHMDID
KVSFTGSTEVGRLVMEAAAKSNLKPVSLELGGKSPVIVFDDADLDTAVNLVHMASYTNKG
EICVAGSRIYVQEGIYDAFVKKATEMAKKSVVGDPFNPRVHQGPQIDKEQYEKILKYIDI
GKREGATLVTGGKPCGENGYYIEPTIFTDVKEEMSIAQEEIFGPVMALMKFKTVEEAIQK
ANSTRYGLAAGIVTKNIDVANTVSRSIRAGAIWINCYLGFDPDVPFGGYKMSGFGKDMGM
DALEKYLHTKAVVTPLYNTPWL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcgaacggcggcgacagcaaggggttcgaggtgccgaagctggagatcaag
ttcaccaagctcttcatcaatggccgcttcgtcgacgccgtctccggcaagacattcgaa
acccgtgacccgcgcaccggcgaggtcatcgccaagatcgccgaaggagacaaggccgac
atcgacctcgccgtgaaggccgccagggaggccttcgaccatggcccctggccaagaatg
tccggctttgcgaggggaaggatcctgcacaagttcgcggacctggtggagcagcacgtg
gaggagctggcggcgctggacacggtggacgccggcaagctgttcgcgatggggaagctc
gtcgacatccccggcggcgcgaacctgctccggtactacgccggcgcggcggacaaggtg
cacggcgagacgctcaagatggcgcggccatgccacgggtacacgctcaaggagcccgtc
ggcgtcgtcggccacatcgtgccgtggaactaccccaccaccatgttcttcttcaaggcc
agcccggcgctcgccgccggctgcaccatggtcgtcaagcccgccgagcagacccccctc
tccgcgctcttctacgcccacctcgccaagcttgccggcgtccccgacggcgtgctcaac
gtcgtccccggcttcggccccaccgccggcgccgctatctcctcccacatggacattgac
aaggtgagcttcaccggctcgacggaggtcggccggctggtgatggaggcggcggcgaag
agcaacctgaagcccgtctcgctcgagctgggtggcaagtctccggtcatcgtgttcgac
gacgccgacctcgacacggccgtgaacctggtccacatggcctcctacaccaacaagggt
gagatctgcgtcgccggctcgcgaatctatgtccaggaggggatctacgatgcgttcgtg
aagaaggcgaccgagatggccaagaaatcggtggtcggagatccgttcaacccgcgagtt
catcaaggccctcagattgacaaggagcaatacgagaagatcctcaagtacatcgacatc
ggtaagcgcgaaggcgcgacgttggtcaccggagggaagccctgcggcgaaaacgggtac
tacatcgagcccaccatcttcacggacgtcaaggaagaaatgtcgatcgcgcaagaggaa
atcttcgggccggtgatggccctcatgaaattcaagacggttgaggaggcgatccagaag
gcgaacagcacccggtacggcctggctgccggcatagtcaccaagaacatcgacgtcgcg
aacacggtttcgcggtcgatccgggcaggggcaatctggatcaattgctacctcggcttc
gaccccgacgtgccgttcggggggtacaagatgagcggcttcggcaaggacatgggcatg
gacgcccttgagaagtacctccacaccaaggcggtggtcacccctctctacaacacccct
tggctatga

DBGET integrated database retrieval system