KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326483
Entry
4326483           CDS       T01015                                 
Name
(RefSeq) glutathione S-transferase 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4326483
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:osa02000]
    4326483
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     4326483
Transporters [BR:osa02000]
 Other transporters
  Pores ion channels [TC:1]
   4326483
SSDB
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C_5
Other DBs
NCBI-GeneID: 4326483
NCBI-ProteinID: XP_015645399
UniProt: A0A0P0V293 Q0JMX6
Position
1:14167593..14168853
AA seq 217 aa
MLVCLEEAGVEYEVVPLSLTNGDHRRPEHLARNPFGQIPVLEDGDLTLYQSHAIARYVLG
KHKPELLGLGEGGSVEESAMVDMWLEVETHQYEAAVKPIVWHCLVHQHVGLVRDQGVVDE
SVEKLRAVLEVYEARLSSSSAGRYSYLAGGGSGDRVSLADLSHVPLMHYFTATEYGGVLG
EYPRVKAWWEALLARPSVKKVIAGMPTDFGFGSGNLP
NT seq 654 nt   +upstreamnt  +downstreamnt
atgctggtgtgcctggaggaggccggcgtcgagtacgaggtcgtcccgttgagcttgacc
aacggcgaccaccgccggccggagcacctcgcccggaacccattcggtcagattccagtg
ctggaggacggtgacctgacactctaccaatcacacgcgatcgctaggtacgttctcggc
aagcacaagccggagctcctggggctcggcgaaggcggcagcgtggaggagtcggcaatg
gtggacatgtggctggaggtggagacccaccagtacgaggccgccgtgaagcccatcgtg
tggcactgcctcgtccaccagcacgtcggcctggtgcgcgaccagggcgtcgtggacgag
agcgtggagaagctgagggcggtgctggaggtgtacgaggcgaggctgtcgtcgtcgtcg
gccggcaggtacagctacctcgccggcggcggcagcggcgaccgcgtcagcctcgccgac
ctcagccacgtcccgctgatgcactacttcacagcgacggagtacggcggcgtgctgggc
gagtacccgcgcgtgaaggcgtggtgggaggcgctgctggcgcggccgtcggtgaagaag
gtgatcgccggcatgcccaccgatttcgggttcggaagtgggaacttgccatag

DBGET integrated database retrieval system