KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326671
Entry
4326671           CDS       T01015                                 
Name
(RefSeq) uroporphyrinogen-III C-methyltransferase
  KO
K02303  uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4326671
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     4326671
SSDB
Motif
Pfam: TP_methylase
Other DBs
NCBI-GeneID: 4326671
NCBI-ProteinID: XP_015619731
Position
1:25234666..25238165
AA seq 384 aa
MALALRPPRFQPLPAPIPASTASTTALAARPSSSAHAIICAAAASPFTEATSSSRYRRDA
WSYAASDGDSSSSSAAAAAAAASSGRRDDEIALQLPELRRLLEALRASRGRGAEGEGGGG
GPGRVALVGTGPGDPELLTLKAVRAIEAADLVLYDRLVSNDVLDLVGEGARLLYVGKTAG
YHSRTQEEIHELLLSFAEAGANVVRLKGGDPLVFGRGGEEMDFLQQQGIRVEVIPGITSA
SGIAAELGIPLTHRGVATSVRFLTGHSRNGGPDPLYVAENAADPDTTLVVYMGLSTLPSL
APKLMKHGLPPDTPAVAVERGTTPQQRMVFAMLKDFVNEVKSEDLVSPTLIIIGKVVALS
PFWIDSSKQGAQSIENLYAAETKR
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggcgctcgcccttcgaccaccgcgcttccagcctctccccgcccccattcccgcgtca
accgcctccaccaccgctctcgccgcacggccctcctcctccgctcacgccatcatctgc
gccgctgctgcttcgcccttcaccgaggccacatcctcctcgcggtaccgccgcgacgcc
tggtcctacgccgcctcggatggcgattcgtcgtcgtcgtccgctgctgcggctgcggcg
gcggcttcttcgggtcgccgggacgacgagatcgcgctgcagctgccggagctgaggagg
ctgctggaggcgctgcgggcgtcgagagggaggggggcggaaggggagggcggcggcggc
gggcccgggagggtggcgctggtggggacggggcccggtgacccggagctgctcacgctc
aaggcggtgcgggccatcgaggcggcggacttggtgctctacgaccgcctcgtctccaac
gacgtgctcgatttggtcggggagggcgccaggctgctctacgtcggcaagacggccgga
taccacagccgcacccaggaagagattcatgagctgctactaagcttcgcagaggctggt
gccaatgtggtgcggttgaaaggcggcgaccctctggtctttggaaggggtggagaagag
atggatttccttcaacaacaaggaataagagttgaagttatcccaggaattacatcagct
tcaggaattgcagcagaacttggcattccactaacccatagaggtgttgctaccagtgtc
agatttttaactgggcactctagaaatggtgggccagatcctctatatgtggcagagaat
gcagcagatcctgacacaactttagttgtgtatatgggtttgtcaacactgccatctctt
gctcccaagttgatgaagcatggtcttccaccggatacaccggctgttgcagttgagcgt
ggcactaccccccaacaacgcatggtattcgccatgttaaaggattttgtgaatgaagtc
aagtcggaggatctagtctctcctactctgataattattgggaaggtggtggcattgtca
cccttttggatcgattcatccaaacagggtgcacaatccattgagaatttgtacgcagcc
gagaccaaaagataa

DBGET integrated database retrieval system