KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326716
Entry
4326716           CDS       T01015                                 

Definition
(RefSeq) peroxidase 2
  KO
K00430  peroxidase [EC:1.11.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4326716
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     4326716
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 4326716
NCBI-ProteinID: XP_015625718
UniProt: A0A0P0V1A3 Q9FYP0
Position
1
AA seq 347 aa
MRLSVAILCALVAVQAAALLLAGSAAAASELKVGYYHKKCKGVENVIKWHVIKALKQNRR
TGAALVRLLFHDCFVRGCDGSVLLDKSYENPHPEKEAPVNIGLAAFDLLEEIKAAVEKRC
PGVVSCSDILIYAARDAGSILSNGHVHFDVPAGRLDGVVSRADEAQAELPDSTMTVQQLK
DNFAAKGFDTEQLVILSGAHSIGQGHCSSFTGRLSEPPQQITPAYRDLLNYKCSQAANPD
VVNNVRDEDASVVARFMPGFVSRVRKISDFLDNTYYHNNLAKIVTFHSDWQLLTDATSLS
KVHEYADNATLWDSDFSDSLLKLSQLPMPEGSKGEIRKKCSAINHLY
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaggctgtcggtggccatcctctgcgccctcgtcgccgtgcaggcggcggcgctgctc
ctcgccggatcggcggccgcggccagcgagctcaaggtcgggtactaccacaagaagtgc
aagggcgtcgagaacgtgatcaagtggcacgtcatcaaggctctcaagcagaaccgccgc
accggcgctgccctagtccgcctcctcttccacgactgcttcgtcaggggttgcgatggg
tcagtcctgctggacaagtcgtacgagaacccacacccggagaaggaggcgccggtgaac
atcgggctggcggcgttcgacctcctggaggagatcaaggcggccgtggagaagcggtgc
cccggcgtggtgtcctgctccgacatcctcatctacgcggcgcgcgacgccggcagcatc
ctcagcaacggccacgtccacttcgacgtccccgcgggccgcctcgacggcgtcgtctcc
agggccgacgaggcccaggcggagctcccggactccaccatgaccgtgcagcagctcaag
gacaacttcgccgccaagggcttcgacaccgagcagctggtcatcctctccggcgcgcac
tccatcggccagggccactgctcctccttcaccggccgcctctccgagccgccgcagcag
atcaccccggcgtaccgcgacctcctcaactacaagtgctcccaggccgccaacccggac
gtcgtcaacaacgtccgcgacgaggacgcctccgtcgtcgccaggttcatgccgggcttc
gtcagccgcgtccgcaagatcagcgacttcctcgacaacacctactaccacaacaacctc
gccaagatcgtcaccttccactccgactggcagctgctcacggacgccacgtcgctctcc
aaggtccacgagtacgccgacaatgccaccctttgggactccgacttctccgactcgctg
ctcaagctcagccagctgcccatgccggaggggagcaagggggagatcaggaagaagtgc
agcgccatcaaccacttgtactaa

DBGET integrated database retrieval system