KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326797
Entry
4326797           CDS       T01015                                 
Name
(RefSeq) GTP-binding protein SAR1A
  KO
K07953  GTP-binding protein SAR1 [EC:3.6.5.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4326797
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4326797
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:osa04031]
    4326797
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-
     4326797
Membrane trafficking [BR:osa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    4326797
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Sar
    4326797
SSDB
Motif
Pfam: Arf G-alpha Roc SRPRB MMR_HSR1 Ras PduV-EutP Gtr1_RagA
Other DBs
NCBI-GeneID: 4326797
NCBI-ProteinID: XP_015621967
UniProt: A0A8J8Y1A8 Q93W16
Position
1:13286108..13288445
AA seq 193 aa
MFLWDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELS
IGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKKELDALLSDDSLA
AVPFLILGNKIDIPYAASEEELRYHLGLSNFTTGKGKVSLGESNVRPLEVFMCSVVRKMG
YGDGFKWVSQYIK
NT seq 582 nt   +upstreamnt  +downstreamnt
atgttcctgtgggactggttctacggcgtgctcgcgtcgctggggctgtggcagaaggag
gccaagatcctcttcctcggcctcgacaacgccggcaagaccaccctcctccacatgctc
aaggacgagaggttggtgcagcaccagccgacgcagcacccgacgtcggaggagctcagc
atcgggaagatcaagttcaaggccttcgatctcggcggccaccagatcgcccgccgcgtc
tggaaggactactacgccaaggttgatgctgtggtatatttggtagatgcttatgataag
gaacgttttgctgagtcaaaaaaggagcttgatgcactcctatctgatgattcattggca
gctgtcccgtttcttatccttggcaacaagattgacattccatatgctgcttctgaagag
gagctgcggtatcatctaggccttagcaacttcacaactgggaagggcaaggtcagccta
ggtgaatccaatgtccggcccctcgaagtgttcatgtgcagtgttgtccgcaagatgggc
tatggtgacgggttcaagtgggtctcccagtacatcaagtag

DBGET integrated database retrieval system