KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326917
Entry
4326917           CDS       T01015                                 
Name
(RefSeq) tubulin beta-1 chain
  KO
K07375  tubulin beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4326917
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:osa03036]
    4326917
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:osa04812]
    4326917
   04147 Exosome [BR:osa04147]
    4326917
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Microtubules and associated factors
    Other tubulins
     4326917
Cytoskeleton proteins [BR:osa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    4326917
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4326917
  Exosomal proteins of colorectal cancer cells
   4326917
  Exosomal proteins of bladder cancer cells
   4326917
SSDB
Motif
Pfam: Tubulin Tubulin_C Tubulin_3 Tubulin_2 Misat_Tub_SegII
Other DBs
NCBI-GeneID: 4326917
NCBI-ProteinID: XP_015620877
UniProt: Q43594
Position
1:complement(10099386..10103029)
AA seq 447 aa
MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYVGTSDLQLERVNVYYNEASCGRFV
PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMM
CAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRG
LSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEEGDYEDEEEQVPEDE
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagggagatcctgcacatccagggcgggcagtgtggcaaccagatcggctccaagttc
tgggaggtggtctgcgacgagcacggcatcgaccccaccggccgctacgtcggcacctcc
gacctccagctcgagcgcgtcaacgtctactacaatgaggcctcctgcggccgcttcgtg
ccccgcgccgtgctcatggacctcgagccgggtaccatggacagcgtccgcaccggcccc
tatggccagatcttccgccccgacaacttcgtcttcggccagtccggcgccggcaacaac
tgggccaaggggcactacaccgagggcgcggagctcatcgactctgtgctcgatgtcgtc
aggaaggaggctgagaactgcgactgcctccaaggtttccaagtttgccattcccttgga
ggaggcactggatctggaatgggcacactcctgatctccaagatcagagaggagtaccct
gaccggatgatgctcacattttctgtcttcccttcaccaaaggtctcagacacagttgtt
gagccttacaatgcaactctctctgtccatcagttggtggagaatgctgatgagtgcatg
gttcttgacaatgaggcactttatgacatctgcttccgcaccctcaagctgaccactcct
agctttggcgacctgaaccacttgatcagtgctacaatgagtggagttacttgctgcctt
cgcttccctggtcaattgaactctgacctccgcaagctggccgtgaacttgatccctttc
cctcgcctgcacttcttcatggtgggctttgcgccactcacctcgcgtggctcgcagcag
tatcgcgccctcactgtccctgagctcacccagcaaatgtgggacgccaagaacatgatg
tgtgccgctgacccgcgccatggccgctacctcacggcctccgccatgttccgtggcaag
atgagcaccaaggaggtggacgagcagatgatcaacgtccagaacaagaactcgtcctac
ttcgtcgagtggatccccaacaacgtgaagtccagcgtgtgcgacatcccgccgcgcggc
ctctccatggcgtccaccttcatcggcaactccacctccatccaggagatgttccgccgc
gtgagcgagcagttcaccgccatgttcaggaggaaggccttcttgcattggtacaccggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaacgaccttgtctcc
gagtaccagcagtaccaggatgccaccgccgacgaggagggcgactacgaggacgaagag
gagcaggtccccgaagacgagtaa

DBGET integrated database retrieval system