KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327131Help
Entry
4327131           CDS       T01015                                 

Definition
(RefSeq) acyl-protein thioesterase 1 homolog 1
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    4327131
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     4327131
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 FSH1 Hydrolase_4 Peptidase_S9 DLH Lipase_3 LIP
Motif
Other DBs
NCBI-GeneID: 4327131
NCBI-ProteinID: XP_015631233
UniProt: Q94E46
Position
1
AA seq 257 aa AA seqDB search
MSSFGGTSSVASGGGKRLEYGRTHVVRPKGAHKATIVWLHGLGDNGASWSQLLETLPLPN
IKWICPTAPTRPVAVFGGFPSTAWFDVADLSEDAPDDVEGLDASAAHVANLLSTEPADIK
LGVGGFSMGAATALYSATCYAHGKYGNGNPYPVNLSVSVGLSGWLPCARSLKNKIESSQE
AAQKASSIPLLLCHGKADDVVLYKHGEKSADALKTTGFSNVVFKSYNRLGHYTVPEEMDE
VCKWLTANLGVSSSSSA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcttcggcggcaccagctccgtcgcctccggtggtgggaagaggctcgagtac
gggcggacgcatgtcgtgaggcccaagggcgcgcacaaggccaccatcgtctggctccac
ggcctcggggacaacggagccagctggtctcaactactggaaacccttccccttcccaat
ataaaatggatttgccccaccgcgcctacaaggccagtggcagtttttggtgggttccca
tcaactgcatggtttgatgttgctgatctttcagaagacgctcctgatgatgttgagggg
ttggatgcctcagctgcacatgttgcaaacttattatcaactgagccagctgacatcaaa
cttggtgttggtggctttagcatgggcgcagctaccgccctttactctgcaacctgctat
gctcatggaaaatacggaaatggcaatccatatcctgtgaacttaagtgtgtctgttggt
ctcagtggctggcttccttgtgccaggtctttgaagaacaaaattgaaagctcacaggag
gctgcacaaaaggcttcatccatacctcttttgctttgtcatggaaaagctgatgatgta
gttctctacaagcatggtgagaaatctgctgacgcactgaagacaactggattttcaaat
gtggtgttcaagtcctacaacagacttggacactacactgttccggaggagatggatgaa
gtctgcaaatggctcaccgcgaacttgggggtcagcagctcatcgtcggcttga

DBGET integrated database retrieval system