KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327189Help
Entry
4327189           CDS       T01015                                 

Definition
(RefSeq) hydroxyphenylpyruvate reductase isoform X1
  KO
K15919  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4327189
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4327189
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     4327189
    1.1.1.81  hydroxypyruvate reductase
     4327189
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 NAD_binding_7 IlvN
Motif
Other DBs
NCBI-GeneID: 4327189
NCBI-ProteinID: XP_015616718
UniProt: Q8W0A4
Position
1
AA seq 316 aa AA seqDB search
MDSLGVLLVAPMNAYLEQELDRRCRLFRLWESPADRRDDYLRAHASSIRAVVPYALQGVD
AAMIDALPSLEIVSSFSVGIDRVDLDACLRRGVRVTNTPDVLTDDVADLAVGLAIAALRK
IPQADRYVRAGKWKSKGDFTLTTRFSGKRVGIIGLGRIGLAVAKRVEAFDCPVNYYQRTK
QDHPGYTYYPSVVELAASSDVLVVACPLNEHTRHIVNREVMEALGPRGVLINIGRGPHVD
EAAMVAALADGRLGGAGLDVFEDEPNVPEALLGMDNVVLVPHVGSATHETRTAMADLVLG
NLEAHVAGKPLLTQVV
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggattccctgggcgtgctgctggtggcgccgatgaacgcctacctggagcaggagctg
gaccggcggtgccgcctcttccgcctctgggagtcccccgccgaccgccgcgacgactac
ctccgcgcccacgcctcctccatccgcgccgtcgtcccctacgccctccagggcgtcgac
gccgccatgatcgacgccctcccctccctcgagatcgtctcctccttctccgtcggcatc
gaccgcgtcgacctcgacgcgtgcctccgccgcggggtccgcgtcaccaacacccccgac
gtcctcaccgacgacgtcgccgacctcgccgtggggctcgccatcgccgcgctccgcaag
atcccccaggccgaccgctacgtccgcgccggcaagtggaagtccaagggcgacttcacg
ctcaccactcggttcagtggcaagagagtcggcatcatcggtttgggcaggatcgggctc
gccgtcgcgaagcgagtggaggccttcgactgcccggtgaactactaccagaggacgaag
caggatcaccccggctacacctactacccgtcggtggtggagctggcggcgagcagcgac
gtgctggtggtggcgtgcccgctgaacgagcacacccggcacatcgtgaaccgggaggtg
atggaggcgctggggcccaggggcgtgctgatcaacatcggccgggggccgcacgtcgac
gaggcggcgatggtggcggcgctggccgacggccggctcggcggcgccgggctggacgtg
ttcgaggacgagccgaacgtgcccgaggcgctgctcgggatggacaacgtcgtgctggtg
ccgcatgtgggcagcgcgacgcacgagacgcgcacggccatggccgacctggtgctcggc
aacctggaggcgcatgtcgccggcaagccgctgctgacgcaggtggtgtga

DBGET integrated database retrieval system