KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327253
Entry
4327253           CDS       T01015                                 

Definition
(RefSeq) calmodulin-binding transcription activator 4 isoform X1
  KO
K21596  calmodulin-binding transcription activator
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4327253
Transcription factors [BR:osa03000]
 Eukaryotic type
  Other transcription factors
   Others
    4327253
SSDB
Motif
Pfam: CG-1 Ank_4 Ank_2 IQ Ank Ank_3 TIG Ank_5 GH-E
Other DBs
NCBI-GeneID: 4327253
NCBI-ProteinID: XP_015649554
UniProt: Q5JJP3 Q5JJQ1
Position
1
AA seq 878 aa
MQHQQGFDTHRLHQEVKSRWLKPKEVLQILQNHDRFIITHKTPHKPPSGAWFLFNRRVLR
YFRNDGYEWRKKKNGKTIAEAHERLKVDNVDALNCYYAHADKNSTFQRRIYWMLDPAYDH
IVFVHYRDVQEGSISVSALNDSSTSNQNGSGSRAEAQSSPGLTSELFAPCLNSCSPGSAE
EVSSQIMAINNETNSVSQPDWVQHCNQAALRKLKVQLSLEDREDHDVDAKDIPSNSEPIT
VYGIQNEEPGTCRNLADVFSGLEFSKENHPEETGLPFSSTIDVLKNSDTWLEEDQIEAIL
HSASMIVTENQWFNIREVSPEWSYCSESTKVIIAGDFLRDPSHGSWAIVFGDVKVHAEIV
QQGVIRCHTPCLDARKVTMYLIDENEKACSEARQFEFHNKPTKSVVCENRKPCREVHESE
LHQRPTESNNELLLLFNYAQLLFDGHVSEQFLKFGLPFPNLECGLQVSPSEIMKGASERL
NRDTAVNCVMEVLLNNKFEEWLFSKYEQNSEGNHFLPRQYHGVIHTIAALGYNWALKLLL
NSGVLVNYRDANGWTALHWAARFGREETVVLLLDAGAAAGALSDPTAQDPAAKTPASVAS
AYGFKGLSAYLSEAELIAHLHSLESKENGSSGDQISRVVGRISDTSAHAQSGSDDQLALK
ESLGAMRYAVQAAGRIQTAFRIFSFRKKQQAGLQNRGNHIISIREVGAASHGMLEKAALS
IQKNFRCWKKRKEFLKIRKNVIKIQARVRAHQQHNKYKELLRSVGILEKVMLRWYRKGVG
LRGFHPGAIAMPIDEEDEDDVAKVFRKQRVETALNKAVSRVSSIIDSPVARQQYRRMLKM
HKQNKDDDEKVEVSPASHVYGSGSHHMCWLSHNNKAMH
NT seq 2637 nt   +upstreamnt  +downstreamnt
atgcagcaccagcaaggatttgatacacacaggctacaccaggaagtaaaatcgcggtgg
ttaaagcctaaagaggttctgcagatattgcagaatcatgatcggttcatcatcacacat
aagactcctcataagccaccgagtggtgcttggtttcttttcaaccgtagagttcttcgg
tacttcagaaatgatgggtatgaatggcgaaaaaagaagaatgggaagactattgctgaa
gcccatgagcgccttaaggttgataatgttgatgcactgaattgctactatgcacacgca
gacaaaaactctacatttcagaggcgtatatattggatgcttgatccggcttatgatcac
atagtttttgtccactacagagatgttcaagagggcagcatttcagtatcagcactgaat
gattcatcaacatccaatcagaatggcagtggtagcagagctgaggctcaaagttcaccc
ggattgactagcgagctatttgccccatgtcttaattcatgcagtccaggatctgcggaa
gaagttagttcccagattatggccataaacaacgaaacaaatagcgttagtcaacctgat
tgggttcaacattgtaatcaggcagcgctgcgaaaacttaaggtgcagctgagtctggaa
gatagggaagatcatgatgtcgatgccaaagatattccatcaaacagtgaacctatcact
gtgtatgggattcagaatgaagaaccaggcacttgtagaaatcttgcagatgtttttagt
ggactggagttcagcaaagaaaatcatcctgaagaaaccggactccctttttccagcact
attgatgtgctgaaaaattcagacacttggttggaggaggatcagattgaagcaattctg
cattcagcatctatgatagtgactgaaaaccaatggttcaatattcgtgaggtttcccca
gaatggtcctattgttctgaaagtacaaaggttatcattgcaggagacttccttcgtgat
ccctctcatggttcatgggcaatagtatttggcgatgttaaggtacatgcagaaattgtt
cagcaaggtgtcattcgttgccatactccatgccttgatgctagaaaagtgacaatgtac
ttgattgatgaaaatgagaaagcctgcagtgaagcacgacaattcgaattccataataag
cctaccaaaagtgtggtttgtgagaacaggaaaccctgcagagaagtacatgaatctgaa
ctccatcagaggcctactgaaagcaacaatgagctattgttgctttttaactatgctcag
ttgcttttcgatggtcatgtttctgagcaatttttaaagtttggcttgccattcccaaat
cttgaatgcggactccaagttagcccatctgaaattatgaagggggcatctgagcggctg
aaccgtgacaccgcagtaaattgtgtcatggaagtactgcttaacaacaagtttgaagag
tggctgttttctaaatatgaacaaaatagtgaagggaatcattttctccctaggcaatac
catggtgttatacatacaattgctgccttggggtacaactgggctttgaaacttctgctt
aattcaggtgtacttgtaaactaccgtgatgcaaatggatggactgctttacattgggct
gcacgatttggcagggaagagacggtagtgctccttcttgatgcaggtgccgcagctggt
gcactgtcagacccaacagcacaagatcctgctgccaaaacacctgcttcagtagcttct
gcatatggtttcaagggcctttctgcgtatctttcagaagcagaactaatagctcatctt
cattctctcgaatcaaaagaaaacgggtcttctggagatcaaatatcaagagttgtgggc
agaatatcagacacatctgcccatgcacaaagtggtagcgatgatcagcttgcactgaag
gaatccctaggagctatgcgatatgctgttcaagctgccgggcgcatacaaactgccttc
cgtattttttccttcaggaagaaacaacaagcaggtcttcagaatagaggtaaccacatt
atatccattcgtgaggtaggtgctgcttcacacggtatgcttgagaaagccgcgttatct
atccagaagaacttcaggtgctggaagaaacgcaaagaatttctgaaaatacgcaaaaat
gtcatcaagatacaggcgcgtgtcagagctcatcaacaacataacaagtacaaggagtta
cttcgaagtgtgggcatccttgagaaggtcatgcttagatggtaccgaaagggtgttggt
ttacgaggattccaccctggggcaatagcaatgccaatcgatgaagaggacgaagatgac
gtagccaaggttttccggaagcaaagagtggaaacagctctcaacaaagctgtttcaagg
gtatcatcgatcatcgacagtcctgtcgcgagacagcaataccgaaggatgctcaaaatg
cacaaacaaaacaaggatgatgatgaaaaagtagaagtttctccagcatctcatgtttat
ggcagtggcagtcatcacatgtgttggctaagccacaacaacaaagcaatgcactag

DBGET integrated database retrieval system