KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327905
Entry
4327905           CDS       T01015                                 
Name
(RefSeq) protein TsetseEP
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Other DBs
NCBI-GeneID: 4327905
NCBI-ProteinID: XP_015622520
UniProt: Q9ARY7 A0A8J8XKD2
Position
1:10133862..10135328
AA seq 273 aa
MARRRHACFLLLLPLLVLQLLLAGGSLVDDLPAATHQVPRLVGPQRKLQQLPNPRPQPQP
LPQPNPNPQPQPLPQPQPQPQPQPQPLPQPQPQPQPLPLPGPQPLPQPGPQPNPNPQPLP
QPNPNPQPLPQPDPNAPPLPLPQPNPNNPQPLPQPDPNAPSLPLPQPDPNAPPLPLPQPD
PNAPPQPLPQPDPNNPQPLPQPDPNAPPQPLPQPDPNSPPQPLPQPDPNTPPGQQINAKI
SSQPDSIGGARTLYPYGVIYNLMPLFSLFFYMF
NT seq 822 nt   +upstreamnt  +downstreamnt
atggcgaggcgtcgccatgcttgctttcttctcctgctgcctctgctggtgctgcagctt
cttcttgctgggggaagcttggttgatgatcttcctgctgcaactcatcaggtgccgagg
ttagtagggccacagcgcaagttacagcagcttccaaacccaaggccacagccgcaacca
ttgccccagccaaacccaaatccacagccacaaccactcccacagccacagccacagcca
caaccacaaccacaacctctgccacaaccgcagccgcaaccacagcctttaccgctacca
ggcccacaaccattaccgcaacccggcccgcagccgaacccaaacccccaaccgttacca
cagccaaacccaaatccccagcctttacctcagccagacccgaacgctccgccgttgcct
ctgccgcagcctaacccaaacaacccgcaacctctgccgcagccagaccctaacgcgcca
tcactacctctgccgcagccagacccaaacgcgccaccactgcctctgccacaacctgat
ccgaacgcgccaccacaacctttgccgcaaccagacccaaacaaccctcaacctttaccg
caacctgaccctaacgcaccaccacagcctttgccgcaaccagaccctaactcgccgcca
cagcctttgccgcaaccagacccgaacacgcctcctggccaacaaattaatgcaaagata
tcatcacagccggattctattggtggagccagaactttatatccatacggtgtaatatac
aatctcatgccattgtttagcctattcttctatatgttttga

DBGET integrated database retrieval system