KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327929
Entry
4327929           CDS       T01015                                 
Name
(RefSeq) protein transport protein Sec61 subunit beta
  KO
K09481  protein transport protein SEC61 subunit beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
osa04141  Protein processing in endoplasmic reticulum
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4327929
   04141 Protein processing in endoplasmic reticulum
    4327929
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4327929
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4327929
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4327929
SSDB
Motif
Pfam: Sec61_beta
Other DBs
NCBI-GeneID: 4327929
NCBI-ProteinID: XP_015650877
UniProt: Q0JLV5 A0A8J8YE10
Position
1:21631119..21635478
AA seq 80 aa
MVANGDAPARGSAAAAASLRRRRTTSSGTGGGGASTMLQFYTDEAAGRKMSPNSVLIMSI
GFIAVVALLHVFGKLYRTSA
NT seq 243 nt   +upstreamnt  +downstreamnt
atggtggccaatggagatgccccggctagagggagtgcagcagctgctgcaagcttgcgc
aggcgtagaaccaccagcagtggcactggtggaggcggtgccagcacaatgctccagttc
tacaccgatgaggctgctgggcgcaagatgtccccgaactcagtcctcatcatgagcatt
gggttcattgccgtcgttgctcttctgcatgttttcggcaagctttaccgcacctccgcc
tag

DBGET integrated database retrieval system