KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328048Help
Entry
4328048           CDS       T01015                                 

Definition
(RefSeq) 60S ribosomal protein L37-1
  KO
K02922  large subunit ribosomal protein L37e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Module
osa_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:osa00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    4328048
Ribosome [BR:osa03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    4328048
  Archaea
    4328048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L37e DZR SelR DUF3839
Motif
Other DBs
NCBI-GeneID: 4328048
NCBI-ProteinID: XP_015626988
UniProt: Q6Z8Y5
Position
2
AA seq 94 aa AA seqDB search
MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG
TGRMRYMRHVPRRFKSNFREGTEATPRKRAAAAN
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atggggaagggtacgggcagcttcggcaagcgccggaacaagacgcacacgctctgcgtc
cgctgcggccgccgcagcttccacctccagaagagcacctgctcctcctgcggctacccc
gccgcccgcatccgcaagtacaactggagcgtgaaggccattaggcgcaagaccacagga
actggaaggatgaggtacatgcgacatgtgcctaggaggttcaagagcaacttcagagaa
ggtactgaggctaccccaaggaagagagctgccgcagccaactag

DBGET integrated database retrieval system