KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328496Help
Entry
4328496           CDS       T01015                                 

Definition
(RefSeq) protein ECERIFERUM 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: Wax2_C FA_hydroxylase adh_short CAAD
Motif
Other DBs
NCBI-GeneID: 4328496
NCBI-ProteinID: XP_015623214
UniProt: Q6ETL8
Position
2
AA seq 628 aa AA seqDB search
MAAPPLSSWPWASLGSYKYVLYGAVVWKVAEEWRQQGAAPVGSWWLHLLLLFAARGLTYQ
FWFSYGNMLFFTRRRRVVPDSVDFRQVDAEWDWDNFLLLQTLIGATLVGSPAVARQQLLL
PSLKQAWDPRGWAIALLLHVLVAEPLFYWAHRALHRAPLFSRYHAAHHHASVTTPLTAGF
GTPLESLLLTVVIGVPLAGAFLMGVGSVGLVYGHVLLFDFLRSMGYSNVEVISPRVFQAV
PLLRYLIYTPTYLSLHHREKDSNFCLFMPIFDLLGGTLNHKSWELQKEVYLGKNDQAPDF
VFLAHVVDIMASMHVPFVLRSCSSTPFANHFVLLPFWPVAFGFMLLMWCCSKTFLVSSYR
LRGNLHQMWTVPRYGFQYFIPAAKKGINEQIELAILRADRMGVKVLSLAALNKNEALNGG
GTLFVNKHPELRVRVVHGNTLTAAVILNEIPSNVKDVFLTGATSKLGRAIALYLCRKKIR
VLMLTLSSERFLKIQREAPAEFQQYLVQVTKYQPAQNCKTWLVGKWLSPREQRWAPAGTH
FHQFVVPPIIGFRRDCTYGKLAAMRLPKDVQGLGYCEYTMERGVVHACHAGGVVHFLEGW
EHHEVGAIDVDRIDVVWKAALKHGLTPA
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcctcctctctcgtcgtggccatgggcaagcctcggctcgtacaagtatgtg
ttgtacggggcggtggtgtggaaggtggcggaggagtggaggcagcaaggggcggcgccg
gtggggtcgtggtggctccacctgctgctgctgttcgccgcccgcgggctcacctaccag
ttctggttctcctacggcaacatgctcttcttcacccgccgccgccgcgtcgtccccgac
tccgtcgacttccgccaggtcgacgccgaatgggactgggataactttctgctgctgcag
acgctgataggggcaacgttggtggggagcccggcggtggcgcggcagcagctgctgctc
ccaagcctgaagcaagcgtgggacccacgcgggtgggccatcgcactgctgctgcatgtg
ttggtcgctgagccgctcttttactgggcccaccgggccctgcaccgggccccactcttc
agccgctaccacgccgctcaccaccacgcctcggtcaccacacccttgacagctggattt
gggacgccactggagagcctgctgctgacggtggtgataggggtcccactcgcaggggcc
tttctgatgggggtagggtccgtgggcctggtctatggacacgtccttttgtttgacttc
ttgaggtccatgggctacagtaacgtggaggtgatatcccctagggtcttccaggctgtt
cctcttctcagatacctcatctacacccctacgtacctgagcctgcaccacagggagaag
gactcaaacttctgcctgttcatgcctatttttgatctcctggggggcaccctcaaccac
aagtcatgggagctgcaaaaggaggtctacttaggcaagaacgatcaggcgccggacttc
gtgttcctggcacacgtggtggacatcatggcgtcgatgcacgtgccgttcgtgctccgg
tcgtgcagctcgacgccgttcgccaaccacttcgtcctcctcccgttttggccggtcgcc
ttcggcttcatgctgctcatgtggtgctgctccaagaccttcctcgtcagctcctaccgc
ctccgcggcaacctccaccagatgtggactgtcccccgatatgggtttcagtacttcata
ccggcggcgaagaaaggcatcaacgagcagatcgagctggccatcctgcgtgcagatcgg
atgggcgtcaaggtgctcagcctcgccgctctcaataagaacgaggcactgaatggaggt
ggcacgctgttcgtgaacaagcacccggagctgagggtgagggtggtgcacggcaacacc
ctgacggcggccgtgatcctcaacgagatccccagcaacgtcaaggacgtcttcctcacc
ggcgccacctccaagctcggcagagccatcgccctctacctctgcagaaaaaagatcaga
gtcctgatgttgacattgtcgtcggagaggtttctgaagattcagagggaagcaccggca
gagttccagcagtacctcgtgcaggtcaccaagtaccagcctgcacaaaactgcaagacg
tggctggtggggaagtggctgtcgccgagggagcagaggtgggcgccggcggggacacac
ttccaccagttcgtggtgccgccgatcatcgggttccggcgagactgcacctacggcaag
ctcgccgccatgaggctccccaaggacgtccagggcctcggctactgcgagtacacgatg
gaacgcggggtggtgcacgcgtgccacgccggcggcgtggtgcacttcctggaagggtgg
gagcaccacgaggtgggcgccatcgacgtcgaccggatcgacgtcgtctggaaggcggcg
ctcaagcacggcctcacgccggcgtga

DBGET integrated database retrieval system