KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328734Help
Entry
4328734           CDS       T01015                                 

Definition
(RefSeq) serine/threonine-protein phosphatase PP2A-3 catalytic subunit
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03015  mRNA surveillance pathway
osa04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    4328734
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    4328734
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4328734
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:osa03036]
    4328734
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4328734
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     4328734
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     4328734
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     4328734
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4328734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N ANTAR
Motif
Other DBs
NCBI-GeneID: 4328734
NCBI-ProteinID: XP_015626269
UniProt: Q0E2S4
Position
2
AA seq 307 aa AA seqDB search
MPSSHGDLDRQIAQLRECKHLAEGEVRALCEQAKAILMEEWNVQPVRCPVTVCGDIHGQF
YDLIELFRIGGEAPDTNYLFMGDYVDRGYYSVETVSLLVALKVRYRDRITILRGNHESRQ
ITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALIENQVFCLHGGLSPSLDTLDNIRA
LDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIAQQFNHTNGLSLISRAHQ
LVMEGFNWCQDKNVVTVFSAPNYCYRCGNMAAILEIGENMDQNFLQFDPAPRQIEPDTTR
KTPDYFL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgtcgcacggggatctggaccggcagatcgcgcagctgcgggagtgcaagcac
ctggcggagggggaggtgagggcgctgtgcgagcaggcgaaggccatcctcatggaggag
tggaacgtgcagccggtgcggtgccccgtcacggtctgcggcgacatccacggccagttc
tacgacctcatcgagctcttccgcatcggcggcgaggcgcccgacaccaactacctcttc
atgggcgactacgtcgaccgtggctactactcagtggagactgtttcgttgttggtggct
ttgaaagtacgctacagagatcgaattacaatattgagaggaaatcatgagagcagacaa
atcactcaagtgtacggcttctacgatgaatgcttgagaaagtatggaaatgcaaatgta
tggaaatactttacagacttgtttgattatttgcctctcacagctcttatagaaaaccag
gtgttctgccttcacggtggtctctctccatcattggatactttagataacatccgtgct
cttgatcgtatacaagaggttcctcatgaaggacccatgtgtgatcttttgtggtctgac
ccagatgacagatgcgggtggggaatttcaccgagaggagcaggttatacatttgggcaa
gatatcgctcaacagtttaaccatacaaatggtctatctctcatctcaagggcacatcaa
cttgtaatggaaggatttaattggtgtcaggacaagaatgttgtgacggtcttcagtgca
ccaaactactgttatcgctgtggtaacatggctgcaattcttgagattggcgaaaacatg
gatcagaacttcctccaatttgatccagctcctcggcaaattgaaccagacacaacacgc
aagactcccgactactttttgtaa

DBGET integrated database retrieval system