KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329561Help
Entry
4329561           CDS       T01015                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4329561
   00500 Starch and sucrose metabolism
    4329561
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     4329561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 4329561
NCBI-ProteinID: XP_015625273
UniProt: Q0E0P0
Position
2
AA seq 577 aa AA seqDB search
MGTRLLALAPWLLLLLLQLAGASHVVHRSLEAEQAPSSVPASIVSPLLRTGYHFQPPMNW
INDPNGPLYYKGWYHLFYQYNPKGAVWGNIVWAHSVSQDLINWIALEPAIKPDIPSDQYG
CWSGSATILPDGTPAILYTGIDRPNINYQVQNIAFPKNASDPLLREWVKPAYNPVATPEP
GMNATQFRDPTTAWYADGHWRMLVGGLKGARLGLAYLYRSRDFKTWVRAKHPLHSALTGM
WECPDFFPLQAPGLQAGLDTSVPSSKYVLKNSLDLTRYDYYTVGIYNKVTERYVPDNPAG
DYHRLRYDYGNFYASKTFFDPVKHRRILLGWANESDSVTYDKAKGWAGIHAIPRKVWLDP
SGKQLLQWPIEELETLRGKSVSVFDKVVKPGEHFQVTGLGTYQADVEVSLEVSGLEKAEA
LDPAFGDDAERLCGAKGADVRGGVVFGLWVLASAGLEEKTAVFFRVFKPAGHGAKPVVLM
CTDPTKSSLSPDLYKPTFAGFVDTDISSGKISLRSLIDRSVVESFGAGGKTCILSRVYPS
MAIGDKAHLYVFNNGEADIKISHLKAWEMKKPLMNGA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggggactcggctcttggcgctcgcgccatggctgctgctgctcctcctgcagctcgcc
ggcgcgtcccatgtcgtccaccggagcctcgaggccgagcaggcgccgagctcggtgccg
gcctccattgtcagccccctgctcaggacaggataccacttccagcccccgatgaactgg
atcaacgatccgaacgggccactgtattacaagggatggtaccacctattctaccagtac
aaccccaagggagctgtgtggggcaatatcgtgtgggctcactcggtatcacaggacctc
atcaactggatagcccttgagccggcaatcaagcccgacatcccctccgaccagtacggt
tgttggtctggctctgccaccatccttcccgatggcacgccggcgatcctctacactggg
atcgaccgccccaacatcaactaccaggtgcagaatatcgcatttcccaagaatgcgtca
gacccgctccttcgtgagtgggtcaagccggcctacaacccggtggccacgccggagcct
ggtatgaacgcaacgcaattccgcgatccgacaacggcctggtacgccgacggtcattgg
cggatgctcgttggtggcctgaagggggctcgcctcggccttgcctacctctaccggagc
cgggacttcaagacatgggttcgggccaagcacccactccattcggcgctcactgggatg
tgggagtgcccagacttctttccgttgcaagcaccaggtctccaggctggcctcgacaca
tctgtgccgagcagcaagtacgtgctcaagaacagcctcgatctcacccgttatgactac
tacacggtgggcatctacaacaaggtgacggagcggtatgtgccggacaaccctgctggc
gactaccaccggctccgctatgactacggcaacttctacgcatcaaagaccttcttcgac
ccggtgaagcaccgccgcatcctgcttgggtgggctaacgagtccgacagcgtcacctac
gacaaggcgaagggctgggccggcatccatgcgatcccaagaaaggtatggctggacccg
agcgggaagcagcttctgcagtggccaatcgaggagctggagacgctgaggggcaaatcg
gtcagcgtctttgacaaggtggtgaagcccggggaacatttccaagtcacgggcctcgga
acctaccaggctgacgtggaggtgagcttggaggtgtccgggctggagaaggcggaggcg
ttggacccggcgttcggcgacgacgcggagaggctgtgcggcgcgaagggcgcggacgtg
aggggcggcgtggtgttcgggctgtgggtgctggcctccgccggcctggaggagaaaacc
gccgtcttcttccgcgtcttcaagccggccgggcacggcgccaagcccgtcgtcctcatg
tgcaccgaccctaccaagtcttctcttagcccggatctctacaagccaacttttgccggg
ttcgtcgacaccgacatctcgtccgggaagatctccttgagaagcttgattgaccgttcg
gtggttgagagcttcggcgccgggggcaagacctgcatcctgtcgagagtttacccgtcg
atggcgataggtgacaaggcccatctttacgtcttcaacaatggggaggcggatattaag
atttcacatctgaaagcgtgggaaatgaagaagccgcttatgaatggcgcctaa

DBGET integrated database retrieval system