KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329728Help
Entry
4329728           CDS       T01015                                 

Definition
(RefSeq) ent-pimara-8(14),15-diene synthase isoform X1
  KO
K14038  ent-pimara-8(14),15-diene synthase [EC:4.2.3.30]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00904  Diterpenoid biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    4329728
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.30  ent-pimara-8(14),15-diene synthase
     4329728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth SQHop_cyclase_C SQHop_cyclase_N DUF4357 Prenyltrans
Motif
Other DBs
NCBI-GeneID: 4329728
NCBI-ProteinID: XP_015625948
UniProt: Q6Z5J6
Position
2
AA seq 821 aa AA seqDB search
MILPMSSACLGQFLRASPRGMIEQFNRAPPLRVSIRGAAGVEKSLGLGRNAGSQQGMQKN
QLQDKIRKQLREVQLSPSSYDTAWVAMVPVQGSHQTPRFPQCIEWILQNQHDDGSWGTNL
PGSVVNKDILLCTLACVVALKRWNTGRDHISRGLNFIGKNFWVAMDEQTIAPVGFNITFS
GLLNLATGTGLEFPVMQTDIDGIFHMRKIELERDAYGTASSRRAFMAYVSEGLGSLQDWD
QVMAYQRKNRSIFNSPSAAAATVIHGHNDSALCYLDSLVSKLDGPVPVMYPQNAYSQLGM
VDTLEKMGISNNFSCEISDILDMIYRLWIHNEEELMLDMGTCAMAFRLLRMHGYDISSDG
MAQFVEQSSFDDSIHGYLNDTKALLELYRSSQIRCLEDDLILQDIGSWSARVLQEKISSK
MTHKSEMLEVEYALKFPVYATLERLEQKRNIEQFKTKEQLKIEGFKLLKSGYRGAITHDE
ILALAVDEFHSSQSVYQQELQDLNSWVAQTRLDELKFARLMPSITYFSAAATMFPSELSE
ARIAWTQNCILTTTVDDFFDGDGSKEEMENLVKLIEKWDGHGEIGFSSECVEILFYAIYN
TSKQIAEKAVPLQKRNVVDHIAESWWFTVRGMLTEAEWRMDKYVPTTVEEYMSAAVDSFA
LGPTITSAALFVGPELSEEVFRSKEYIHLMNLANTIGRLLNDMQTYEKEIKMGKVNSVML
HALSHSGGGRGSPEASMEEAKREMRRVLQGSRCDLLRLVTRDGGVVPPPCRKLFWFMSKV
LHFVYMEKDGYFTADGMMASANAVILDPLQVTLLPSGLGTL
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgatacttcctatgagttcagcatgcttaggacaattcctcagagcttcaccccgtggg
atgatagagcagttcaacagagcacctcctcttcgtgtgagcataagaggagctgcaggt
gttgagaagagcctgggattagggaggaatgcgggaagccaacaaggcatgcagaagaac
caactgcaggataagataaggaagcaacttcgggaagttcaattatcaccatcttcatac
gacacggcatgggtagccatggtgccagtgcagggctctcatcaaactccacgcttcccg
caatgtatcgagtggatactgcaaaaccaacatgatgatggatcttggggcacaaacctg
ccaggttcggttgtcaacaaagacattcttttgtgtacattggcatgtgttgttgcactg
aaaagatggaatactggacgagatcacatcagcagaggactgaattttattggaaaaaat
ttctgggttgccatggatgagcaaactattgctcctgtgggttttaacattaccttttct
ggcttgcttaaccttgccactggaacgggtttggaattccctgttatgcaaacagatatt
gatgggatttttcacatgcggaagattgaattggaaagggatgcttatggtacagcttca
tcaagaagagccttcatggcatatgtgtctgaagggttgggcagcctacaagattgggat
caggtaatggcatatcaaaggaagaacagatcgattttcaactcaccttctgcagctgct
gctacagtaatccatggccacaacgatagtgccctctgttacttggattcacttgtaagc
aagctcgatggcccagtcccagtgatgtatccgcaaaatgcttactcacagcttggcatg
gtggatactcttgaaaagatgggtatctctaataatttttcttgtgaaataagtgatata
ttggacatgatatacaggttatggatacacaacgaggaggagctaatgttggacatggga
acatgtgcgatggcatttcgcctactacgtatgcatggttatgacatcagttcagatgga
atggctcaatttgtggaacaatccagctttgatgactcaattcatggatatctaaatgat
actaaggctttgctggagttgtacagaagttcacaaattcgttgcttggaagatgatttg
attctacaagatattggttcttggtcagcaagagtactacaggaaaaaatatcttccaaa
atgacacacaaatcagaaatgctagaggtggagtatgccttgaaattcccagtctatgcc
accttggaaaggctagagcagaagaggaacatagaacaattcaagaccaaggaacaacta
aaaattgagggcttcaagctgctgaaatcaggataccgtggcgctattacacatgacgaa
attctagctttggctgttgacgaattccattcctctcaatctgtctaccaacaagaactc
caagaccttaatagttgggtggcacagaccagattggatgagctgaaatttgcaagatta
atgccatcgatcacctatttcagtgctgctgcaaccatgttcccttctgaattatccgaa
gcccgcattgcatggacccagaactgcatcttgacgaccacagtcgatgacttctttgac
ggtgatggatcaaaagaagaaatggagaacttggtcaaattaatagagaagtgggacggg
cacggtgagattggcttctcctccgagtgtgtagagattctattctatgctatttacaac
acgagcaagcagattgcggaaaaggccgtgccgctgcagaaacgcaatgtcgtggatcat
atcgccgaatcgtggtggttcacagtgaggggcatgttgaccgaggcagaatggaggatg
gacaagtatgtgccaacaacagtggaggagtacatgtcagctgccgtggactcctttgct
ctaggccccaccatcacctcagcggcattgttcgtcggaccagagctctcggaagaggtt
ttcaggagcaaggagtacatccacctaatgaaccttgcgaacactatcggccgccttctc
aatgacatgcagacatacgagaaggaaatcaaaatggggaaggtcaatagcgtcatgttg
catgctctttcccacagcggcggcggccgcggctcaccggaggcatcgatggaggaggcc
aagagagagatgaggagggttctccagggtagtaggtgtgacctcctaaggctggtgact
agagatgggggggttgttcctccaccgtgcaggaagctcttctggttcatgagcaaggtt
ttgcacttcgtctacatggaaaaggacgggtatttcacggccgatgggatgatggcatca
gcaaatgcggtgattcttgatcccctgcaagtgacacttcttccatctggtttgggaacg
ctgtga

DBGET integrated database retrieval system