KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330866Help
Entry
4330866           CDS       T01015                                 

Definition
(RefSeq) separase isoform X1
  KO
K02365  separase [EC:3.4.22.49]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4330866
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:osa03036]
    4330866
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     4330866
Peptidases and inhibitors [BR:osa01002]
 Cysteine peptidases
  Family C50: separase family
   4330866
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    4330866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 4330866
NCBI-ProteinID: XP_015626143
Position
2
AA seq 2241 aa AA seqDB search
MEAAAADLLAALSSPSSQSGLTSRFAAYLEPFSPYLPTLNPSAKPPAKRTAKQRKQQPPP
PPPDAATVRPLAKRFLPFLCRALQVLPLLLRPNPSSGDAGCTDELLDVYALLLDCLAVIS
ACLAGKPYSVLLQRGRFVCCLESRGHYARAEADAAATLDSLRSVLSVPTASKSRRAATAS
FASLLPDPGISGEAGADPEVTILAIELTVCFANCASKCKVKEAAPYERVVSLVDQLQPWL
RILAEDVSRKYLTLLVNALSRCAILLVAEYSVFNTNLVCEFCRATLGECMKAQTIERLPA
VARKICSSVDVSWGGGTQLLLDVLKTVVGSAACLKADLPRAVNGLVEFVAYFSRSFVSSN
WDLSVGAAELIYEQGGYFSEVSSTPATASVLILYAIGLYCSAQQIENRERPHKSTDFLND
EKHLQTLKSALATLAHLFCFANGRSIPLDTMGKASSSSMQPGHSNKKNSLSHSDDHISFV
AYLDSLEFLCKILSQYVNAVWKNFSEGITPNYSINMTYVLTALHQFINSSIAAYSCTEMP
EGDKDKQHEQHGTLLRALVSAMKVSFITNEGIQKSVSFIKCAISSTWIKLDEIKFLMSSL
GNIGVTLYNIGHLDEAPKALELCCQTVWVYARLSYHRLSASQDEQRIIEDIPKDTLKDIS
MDAFAKITKMVDILHRCGVKIIPDIIVKSLSELLANDSTSEFLNSSLVLIKLWVKITHKD
AKDDESVDSAPLLYHSLMGCTPPLPTKLVGLILEQELLAYALVESRGTMFCVEMQKRITN
ILLNKIYCSKEYYLERSRVLVRKARVLRTCGVQSISSCLESLSEAISLLRDIPLDSSQGN
APAIHQLAIAYCLHAHCAQEANLGAEVIFDSAQNVFGLWSKIKTFGYYSPGMISQQPSEN
LVPLLCSLVDLLAMKGCFELQFDLCKLMIIIWKQENLPPEKLFSMLFTNGRLHHACCHLP
MDQQFISIAEHHLDVDCHSTEFWRNCFKGDHPSLCMFLQRLWPIDSFISTTCEPSFRREF
GFGGSVHEVDSVASSLVSDATVNDQSTFLAGYLYFDLSERLLSRGELFQAFSYGKEALHL
RKKLLRKKFKFNFGKFTSGEAQCSGGQNSVSLEAWGSTITEIWPDSTRSTGTRDSFLTPW
TVLQCYLDSILQVALLHELIGNGAEAEVLLRTGKDISQFQGLPVFGVLFASALGQIYRKR
QQWDTAEGELKYARDLLAQNATFISCKLCKLTLDISLDVQAGDLFWSLYEKDFQKQSAGN
LSNALGMYQSALDKLNGTKLESPVDSYDKLKTTCIICSKYGKEPLAANDGVLPSCTVCAN
FSQASGDHSNEFTALKFLKHKDSECCPPLDVKVKRTTRNSSRLAKEQNVEAHVKTRTRSS
KRTAHMKGEKASTELHCKNGLSCSDNLSTDTLVRGKANCILDGVDQSIDYTCSIFGCWNC
LFVNTLNSGSIQNILQFRWDCVWHHNHVSILLKIAKALGAHGGLHGAHKIHNIYWQCISL
LYFRSLPQDCYRTYEHNLFGLIMDQSTGDFLISERAEILYSMSLFLLKGFLSEQSRDICC
RFCSVQMSDVVPWLLKAFVLSRENPSLFQEVCRLLACIFLLATIDSTAQLPLYSSGSLSL
NHWAAYFHQNSVGTYLDCQYFAGLKSLLRKNDSKAALEDFSNASDESLSKFFRFSSADIG
HLEIHIKEFFHKLPDVPIVCISMLEGDFVNVLGEILLLPSYFPAWMMLSRFDSTNKPITM
LLPVDAISKETQHEDSCTKELDNLMRATDKNWQCPWGYTIIDYVAPTFRKILEENFISLS
SATLTLNDGQANHVKWWSHRMKLNNHLDKMLKDMEESWLGPWKCLLLGYDLTDQHIEEAL
TNLIAGLESEFKFEVNPVLIKVILGGAMSVDEVQDCVSQLISYKGYFGRGGCCGKDRLRA
LSSCCIESEALETVECLIKSTVNELIEPVDRDPVIFVLDTNVQMLPWENLPALRNQEIYR
MPSIGSVFLALTRSNNYWKDARVIAPPFPVIDPFNAFYLLNPSGDLSSTQEEFDQMFKNY
EWKGKAGYAPTAEELVLALRNHDLFLYFGHGSGTQYVSGKEIEKLDNCAAALLMGCSSGT
LRCKGCYAPQGAPLSYLSAGSPAVIANLWDVSDKDIDRFSKALLGSWLQENFVAAKNCSK
CCQLTREFESMTIAVEGNGRPRRRGTRGKKSERMNNCSKRCTCGNRRVASYLSEARRACR
LPLMIGGSPVCYGVPTIIRKK
NT seq 6726 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgccgccgccgacctcctcgccgcgctctcctccccgtcctcccaatccggc
ctgacctcccgcttcgccgcctacctcgagcccttctccccctacctacccacgctaaac
cctagcgccaaaccgccggcgaagaggacggcgaagcagcgcaagcagcagccgccgccg
ccgccacccgacgcggccacggtccgcccgctcgctaagcggttcctccccttcctgtgc
cgcgcgctccaggtactcccgctgctactccgccccaaccctagctcaggcgacgccggg
tgcaccgacgagctgctcgacgtttacgccctcctccttgactgcctcgcggtcatatcg
gcgtgcctcgccgggaagccctactccgtgctgctccagcgcggccgattcgtgtgctgc
ctcgagtcgcgcggacactacgcacgcgccgaggcggacgctgctgccactctggattcg
cttcggtctgtgctgtcagtgccgacggcctcaaagtctcgccgtgctgcgactgcgagt
tttgcttccctccttcctgatcctggcatctcaggggaggctggtgcggaccctgaagtc
accatcctcgcgattgagctcaccgtgtgctttgctaattgtgccagcaagtgcaaggtg
aaggaagctgccccatacgaacgggttgtcagccttgttgaccaactccagccatggctt
cggattctggctgaggatgtcagcaggaagtatctgacactgcttgtgaatgcattaagt
cgctgtgccattctcttggttgctgaatattcagtgttcaataccaaccttgtgtgtgaa
ttctgtcgtgcaaccttgggggagtgtatgaaggcgcaaactattgaacgcttgccggca
gttgctcgcaagatttgttcatctgtagatgtgagttggggtgggggcactcagcttttg
cttgatgtcttaaagaccgttgttgggtctgctgcatgtctaaaggctgacttaccaagg
gctgtaaatgggcttgtagaatttgtagcatatttttctcgaagctttgtttcttcaaat
tgggatttatctgttggtgctgctgagctaatttatgaacaaggtggttatttctctgag
gtttcctcaacccctgcaactgcctcagtacttattctttatgccattggattatactgt
agtgctcagcaaattgaaaatagagagcggcctcataaatccacagattttcttaatgat
gaaaagcatctacaaactttaaagagtgcccttgccacactggcacatcttttttgtttt
gccaatggtagatccattccacttgatactatgggtaaagcttctagttcatcaatgcag
cctgggcattctaataagaagaacagtttgtctcactctgatgaccatatatcttttgtg
gcatacctggattcgctagagtttctttgcaagatattatcacagtacgtgaatgcagtt
tggaagaacttctctgaaggaataacacccaattattctataaacatgacctatgtgtta
acagcactgcatcagtttatcaattccagcattgcagcttatagctgtacagaaatgcct
gaaggagacaaggataaacagcatgaacaacatggaaccttgctgagagccctagtttca
gcaatgaaagtttcttttattaccaatgaaggtatccagaagagcgtgtccttcatcaaa
tgtgccatttcaagtacatggataaaacttgatgagatcaaatttctcatgtcctcactt
ggtaacatcggtgtgacgctttacaatattggacatttggatgaggcaccaaaggcttta
gagctatgttgtcaaacagtatgggtgtatgccaggctttcttaccatagactatctgca
agccaggacgaacagagaattattgaggatataccgaaagatacattgaaggacatcagt
atggatgcgtttgctaagattaccaagatggttgacattctccatagatgtggagtaaaa
ataatacctgatattattgtgaagagcttgtctgaattgctggctaatgatagcacatcc
gaatttttgaacagttcattagtcctcatcaagttgtgggttaagataacacacaaagat
gctaaggatgatgaaagtgttgatagtgctccccttctgtaccactctcttatgggttgt
acacctcctttgcctacaaagttggtaggcttaattttagagcaggaattattggcttat
gcattagttgaatctcgaggcactatgttttgtgtagaaatgcaaaagaggatcacaaac
attctgttgaataaaatatactgttcaaaggagtattatttggagagatcgagggtcctt
gttagaaaggcacgtgtgcttcgtacatgtggagtgcaaagtataagcagctgccttgag
tctttatctgaagccatatctttactgcgagacatcccactggattcatctcaaggcaat
gcacctgcaatccatcaattagctattgcatactgcctgcatgcacattgtgcgcaggaa
gccaatcttggtgcggaggtaatctttgatagcgctcagaatgtatttggcctgtggtca
aagatcaaaacttttggttactattctcctggtatgatatctcagcagccatcagaaaat
cttgtaccacttctttgttctttggttgatttgttggcaatgaagggctgctttgagctt
caatttgatctgtgcaagcttatgataattatatggaagcaagaaaacttaccccctgaa
aagttattttccatgctatttaccaatgggcgcctccatcatgcgtgttgtcatctccca
atggaccaacaatttatttcaattgcagagcatcatcttgatgttgattgccatagtaca
gaattttggagaaactgttttaaaggagaccatccttctctttgtatgtttctccagaga
ttgtggcctattgattcctttatttctacgacatgtgaaccttcctttcgaagggaattt
ggtttcggtggtagtgttcatgaggttgatagtgtcgcatcatctttggtttctgatgct
actgtaaatgatcaatcaacctttctagctggctatctgtactttgatttatcagaaaga
cttctatcaagaggagaacttttccaggccttttcatacggaaaagaggccttgcattta
cgcaagaagctcctaagaaagaaattcaaattcaattttggcaagtttacaagtggggaa
gctcaatgttctggagggcaaaactctgtttcacttgaagcatggggatcaacaataact
gaaatttggccagattctaccagatcaactggaacaagagattctttccttactccttgg
actgtactccagtgctatcttgatagcattttgcaggttgctttgctgcatgaattgatt
ggtaatggtgccgaagcagaagttttgttacgaacaggaaaggatatatcacaatttcaa
ggattgccggtttttggtgtccttttcgcatcagctttaggtcaaatataccgcaagaga
cagcaatgggacaccgcagagggcgagcttaaatatgccagggatcttcttgcacaaaat
gctacattcatttcgtgcaagctctgcaagttaactctggatatatcacttgatgtgcaa
gctggagatctattttggagtctatatgagaaagactttcagaaacagtcagcaggcaat
ttgtctaatgctctaggcatgtatcagtctgccctggataaactgaacggcaccaaattg
gaatctcctgttgactcatatgataagcttaaaactacttgcattatctgcagcaaatat
gggaaagaaccattagctgcaaatgatggagtgttaccttcatgtactgtatgtgcaaat
tttagtcaggcttccggtgatcactcgaatgagtttacggcattaaaatttctgaaacat
aaggattctgaatgttgtccaccattggatgttaaagttaaaaggacaaccagaaattca
tcacgtttagctaaagaacagaatgtggaagctcatgtaaaaactaggacgcgctctagt
aagcgaactgctcatatgaaaggtgaaaaggcttcaactgagctacactgtaagaatggc
ctatcttgcagcgataatctgtccacagatactttggtccgtggaaaagcaaactgtatc
cttgatggcgttgaccagagcatagattacacatgcagtatatttggatgttggaattgc
ctttttgtgaatacactcaactctgggtccatccagaatattttgcaattcagatgggat
tgtgtttggcatcacaaccatgtgtctatcctgttaaaaatagcaaaagccttgggtgct
catggaggattgcatggagctcataaaattcataatatctattggcagtgcatatcattg
ttgtactttagatcccttcctcaggattgttatagaacttatgagcataatttatttgga
ctaatcatggatcagagcactggtgattttcttatttcagagagggcagaaatattatat
agtatgagtttgtttttgctcaagggcttcctttcagaacagtcaagggacatatgctgc
cgcttctgcagtgtacaaatgtctgatgttgttccttggttgctgaaagcttttgtgctg
tccagagagaatccctcactttttcaggaggtttgcaggctacttgcatgtatattctta
cttgcaacgattgattccacggctcaattacctttatactccagtggatctctctctttg
aatcattgggctgcatactttcatcagaattctgttggaacctatctcgattgccagtac
tttgctggcttaaaatcattactcagaaaaaatgactcgaaggccgctcttgaagatttt
tcaaatgcgtcagatgagagtctctcaaagtttttcaggttttcatcagcagacatagga
catcttgagatacatataaaagaattcttccataagcttcctgatgtaccaattgtgtgc
attagcatgcttgaaggtgattttgtgaatgttcttggggaaattcttcttctcccttct
tattttcctgcttggatgatgctttcgaggtttgattcaacaaacaaacctattacaatg
cttttgccagtggatgctatttctaaagaaacccaacatgaagattcctgtaccaaagaa
ctggacaatctaatgagagccacagataagaattggcagtgcccttggggctacactata
atagactacgtggctcctacttttagaaagatacttgaggagaactttatttccctctct
agtgcaaccctcactctgaatgatggacaagcaaaccatgtaaagtggtggtcacataga
atgaagctcaacaaccaccttgataagatgctgaaagacatggaggaatcatggctgggg
ccatggaaatgccttctcttggggtatgatttaactgaccaacacattgaggaagctctg
acaaacctgattgctggtctggaatcagaattcaaatttgaagtaaatccagtgctcatc
aaggtcatccttggtggtgctatgtcagtggatgaagtgcaggactgtgtttcccaactt
atatcgtataaaggatattttggccgaggagggtgttgtgggaaagacagacttagagcc
ttatcttcttgctgtattgagtctgaagctctggagacagtcgaatgcttaataaaaagt
acagtgaatgagctgattgaaccagttgatagagatccagtcatttttgttctggacact
aatgtgcagatgcttccttgggaaaacttgcctgcactaaggaatcaagaaatttatcgc
atgccatcaattggaagtgtctttctagctttgactagaagtaataattattggaaagat
gcccgtgttatagctcctccttttcctgtcattgaccctttcaacgcattttatctgttg
aatcctagtggagacctgagcagtacacaagaagaatttgatcagatgtttaagaactac
gaatggaagggaaaggctgggtatgctccaacagctgaagagctggtgttggccttgagg
aatcatgatcttttcctttattttggtcatggaagtggaactcagtatgtctctggaaag
gaaattgagaaattagataattgcgcagctgctcttcttatgggttgcagtagtggaaca
ttgcgttgcaaagggtgttatgctcctcaaggagcccctttatcatatttatctgctggt
tctccagctgttatcgcaaatctctgggatgtgtcagataaggatattgatcgattcagc
aaagcattgctcggttcatggttgcaagagaattttgtagcggccaaaaattgctcgaag
tgttgccagctaacacgagaatttgaatccatgaccattgctgtggagggtaatggcagg
ccgaggcgaagaggcacacgagggaagaagtccgaacgaatgaataactgtagtaagcgt
tgcacttgtggcaacaggcgagtagcttcatatttaagtgaagctaggcgtgcttgcagg
cttcctcttatgatcggtggatctcccgtttgctacggtgtgcctaccatcattaggaaa
aagtaa

DBGET integrated database retrieval system