KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331328Help
Entry
4331328           CDS       T01015                                 

Definition
(RefSeq) putative transporter arsB
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: CitMHS ArsB
Motif
Other DBs
NCBI-GeneID: 4331328
NCBI-ProteinID: XP_015632217
UniProt: Q10SY9
Position
3
AA seq 472 aa AA seqDB search
MSELASAPKVALGSIAFAVFWMMAVFPSVPFLPIGRTAGSLLSAVLMVIFHVISPDDAYA
SIDLPILGLLFATMVVGSYLRNAGMFKHLGRLLAWKSQGGRDLMCRVCVVTALASALFTN
DTCCVVLTEFVLELAAERNLPAKPFLLALASSANIGSAATPIGNPQNLVIAFNSKITFPK
FLMGILPAMLVGMAVNMVMLLCMYWRELGGGAELSVDGKQMEAVEEGRSPASAKSTPQLN
GNGNTMMSLEMSENITTKHPWFMQCTEARRKLFLKSFAYVVTVGMVVAYMVGLNMSWTAI
TTALALVVVDFRDAEPCLDTVSYSLLVFFSGMFITVSGFNKTGLPGAIWDFMAPYSKVNS
VGGISVLSVIILLLSNLASNVPTVLLMGDEVAKAAALISPAAVTTSWLLLAWVSTVAGNL
SLLGSAANLIVCEQARRAPRNAYDLTFWQHIVFGVPSTLIVTAVGIPLIGKI
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcttgcgtcggcgcccaaggtggcgcttggatcgatcgcgttcgcggtgttc
tggatgatggcggtgttcccgtcggtgccgttcctgccgatcgggcggacggcggggtcg
ctgctgagcgcggtgctgatggtgatattccacgtgatcagccccgacgacgcgtacgcc
tccatcgacctcccaatcctgggcctcctcttcgccaccatggtggtgggcagctacctc
cggaacgccgggatgttcaagcacctggggcgtctgctggcgtggaagagccagggcggg
cgcgacctcatgtgccgcgtctgcgtcgtcaccgccctcgccagcgccctcttcaccaac
gacacctgctgcgtcgtcctcaccgagttcgtcctcgagctcgccgccgagcgcaacctc
cccgccaagcccttcctcctcgccctcgcctccagcgccaacatcggctccgccgccacc
cccatcggcaacccccagaacctggtcatcgccttcaatagcaagatcaccttccccaag
ttcctcatgggaatcctcccggccatgctcgtcgggatggccgtcaacatggtcatgctg
ctctgcatgtactggagggagctgggcggaggggccgagctcagcgtcgacggcaagcag
atggaggcggtggaggaaggcaggtcgccggcgtcggccaagagcacgccgcagctgaac
ggcaacggcaacacgatgatgtcgctggagatgtcggagaacataacgaccaagcaccca
tggttcatgcagtgcacggaggcgcggcggaagctgttcctcaagagcttcgcgtacgtg
gtgacggtggggatggtggtggcctacatggtggggctcaacatgtcgtggacggccatc
accacggcgctggcgctggtggtggtcgacttccgcgacgccgagccgtgcctggacacc
gtgtcctactcgctgctcgtcttcttctccgggatgttcatcaccgtcagcggcttcaac
aagacgggcctcccgggagccatctgggacttcatggccccctactccaaggtcaacagc
gtcggcggcatctccgtcctctccgtcatcatcctcctcctctccaacctcgcatcaaac
gtaccaacggtgcttcttatgggtgatgaggtggcgaaggcggcggcgctgatatcgccg
gcggcggtgacgacgtcgtggctgctgctggcgtgggtgagcacggtggcggggaacctg
tcgctgctggggtcggcggcgaacctgatagtgtgcgagcaggcgaggagggcgcccagg
aacgcctacgacctcaccttctggcagcacatcgtcttcggcgtcccatccaccctcatc
gtcaccgccgtcggcatacccctcatcggcaagatctga

DBGET integrated database retrieval system