KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331509Help
Entry
4331509           CDS       T01015                                 

Definition
(RefSeq) catalase-1
  KO
K03781  catalase [EC:1.11.1.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00380  Tryptophan metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa04016  MAPK signaling pathway - plant
osa04146  Peroxisome
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4331509
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    4331509
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4331509
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4331509
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     4331509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-GeneID: 4331509
NCBI-ProteinID: XP_015629749
UniProt: Q10S82
Position
3
AA seq 492 aa AA seqDB search
MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP
ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR
GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP
ESLHMFTFLFDDIGIPADYRHMDGSGVNTYTLVNRAGKSHYVKFHWKPTCGVKSLLDDEA
VTVGGTNHSHATQDLYDSIAAGNFPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDIVPL
QPVGRMVLNRNIDNFFSENEQLAFCPGIIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNY
LLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIPSATLTGRREKV
VIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLSYWSQADRSLGQ
KLASRLSAKPSM
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggatccctacaagcaccgcccgtcgagctcgttcaacggcccgctgtggagcaccaac
tccggcgcccccgtatggaacaacaacaactcgctcaccgtcggctcccgaggcccgatc
cttctggaggactaccacctggttgagaagctggccaacttcgacagggagcgtatcccg
gagcgcgtggtgcacgcccgcggcgccagcgccaagggcttcttcgaggtcacccacgac
atcacccacctcacctgcgccgacttcctccgcgccccgggcgtccagaccccggtcatc
gtccgcttctccaccgtcatccacgagcgcggcagcccggagaccctccgcgacccgcgt
ggcttcgccatcaagttctacacccgggagggcaactgggacctcgtcggcaacaacttc
cccgtcttcttcatccgcgacggcatgaagttcccggacatggtgcactcgctcaagccc
aaccccaagtcgcacgtccaggagaactggcgcatcctcgacttcttctcccaccacccg
gagagcctccacatgttcaccttcctcttcgatgacatcggcatccccgccgactaccgc
cacatggacggctccggcgtcaacacctacacgctcgtcaaccgcgccggcaagtcgcac
tacgtcaagttccactggaagcccacctgcggcgtcaagtcgctgctcgacgacgaggcc
gtcaccgtcggcgggaccaaccacagccacgccacgcaggacctctacgactccatcgcc
gccggcaacttcccggagtggaagctgttcatccagaccatcgaccccgaccacgaggac
cgcttcgacttcgacccgctcgacgtcaccaagacgtggcccgaggacatcgtcccgctg
cagcccgtggggaggatggtgctcaaccgcaacatcgacaacttcttctcggagaacgag
cagctggcgttctgccccgggatcatcgtgccggggatctactactccgacgacaagctg
ctgcagacgaggatcttctcctactccgacacgcagcgccaccgcctcggaccaaactac
ctgctgctcccgcccaacgcgcccaagtgcgcccaccacaacaaccactacgacggcttc
atgaacttcatgcaccgcgacgaggaggtcgactacttcccatcccgctacgatcctgcc
aagcacgccccccgctaccccatcccctccgccaccctcaccggccgccgcgagaaggtg
gtgattgccaaggagaacaacttcaagcagccaggggagaggtaccgttcatgggatccg
gcaaggcaagaccggttcatcaagagatggatcgacgcactctctgaccctcgcctcacc
cacgagatcaggagcatctggctctcctactggtctcaggctgacaggtctctgggtcag
aaactggcgagccgtctcagcgcgaagccgagcatgtaa

DBGET integrated database retrieval system