KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332018Help
Entry
4332018           CDS       T01015                                 

Definition
(RefSeq) methionine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00450  Selenocompound metabolism
osa00970  Aminoacyl-tRNA biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4332018
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4332018
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4332018
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4332018
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     4332018
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   4332018
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4332018
 Prokaryotic type
   Other AARSs
    4332018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 Fox-1_C tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 4332018
NCBI-ProteinID: XP_015632755
UniProt: Q10Q53
Position
3
AA seq 602 aa AA seqDB search
MAAGRAFLRAAPSSLAAGAGRFAFACPTALPLTAAAAAATGPHRRGRGRCYCSASDAPPP
PPYVLTTPLYYVNAPPHMGSAYTTIAADAIARFQRLLDKRVVFITGTDEHGEKIATSAEA
CGRNPKDHCDTISNSYKMLWADLDIEYDKFIRTTDRKHEAVVNDFYSRVLDSGDIYRADY
EGLYCVSCEEYKDEKELGENKCCPVHLKPCVPRKEDNYFFALSKYQHQLEDLLTKNPNFV
RPSHRLNEVQGWVKSGLRDFSISRASVEWGIPVPNDTKQTIYVWFDALLGYISALLDDGE
KASLQQAVERGWPASLHLIGKDILRFHAVYWPAMLMSAGISVPDAVFGHGFLTKDGMKMG
KSLGNTLEPKDLVNRFGVDSVRYFFLREVEFGNDGDYSEERFINIVNAHLANTIGNLLNR
TLGLLKKNCKSTLAFDSIAAADGISLKDNVENLVDKAKDQFENLLLSSACETLMEIGNLG
NLYIDEQAPWSCFKQGGESAEKAAKDLVIILETMRIIAIALSPITPSLSLRIYTQLGFTE
DQFRTLRWEDTKWGGLKAGQVMMEPKPVFARIETETDEKDQSSSKATKGGKKKARSQGLV
EA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgggcgggccttcctccgcgccgccccctcctcgctggccgccggcgccgga
cgcttcgccttcgcgtgcccgacggcccttcccctcactgccgccgccgcggcggcgacc
gggccacaccgtcgcggccgcggccgatgctactgctccgcctccgatgcgccgccgccg
ccgccatacgtgctcaccacgccgctctactacgtcaacgccccgccgcacatggggagc
gcctacaccaccattgccgccgacgccatcgcccgcttccagaggttgctggataagagg
gtcgtatttattaccggaacagatgagcatggcgagaaaattgccacttcagcagaggct
tgtggtagaaacccaaaggatcattgtgatacaatttccaattcatataagatgctttgg
gctgatctagacatagagtatgacaagtttatccgcacaactgatcgtaagcatgaggca
gttgtcaatgacttctattccagagtgctagatagtggtgacatatatagagcagattat
gaaggactttactgtgtgagctgtgaggagtacaaggacgaaaaagagcttggggaaaac
aaatgttgcccagtgcatctaaagccttgtgtaccaagaaaggaagacaactatttcttt
gccttgtcaaaataccagcatcaactggaagatctactgacaaaaaatcctaattttgta
cggccatcacatcgcttgaatgaggtccaaggatgggttaaaagtggattaagggacttc
tctatttcccgtgcatctgtagagtggggtattccggtgccaaatgacaccaaacagaca
atatacgtgtggtttgatgcattattagggtacatttcagcattactagatgatggggag
aaggcaagtttacaacaagcagttgaacgtggttggcctgcctccctacacttgatagga
aaggacatattgcggtttcatgcagtatattggccagcaatgttaatgtcagcaggaata
agtgttcctgatgcagtttttggtcatggatttttgacaaaggatggcatgaagatggga
aaatcattaggcaacacacttgaaccaaaggatctggtaaacagatttggagtagactct
gttaggtacttcttcttgcgggaagtggaatttggcaatgacggggactattcagaggaa
cgctttatcaatatagtcaatgcgcatcttgccaacaccattggaaacctcctcaatcgc
acacttgggctgctaaagaagaattgtaaatccacattagcttttgactcgattgctgcc
gcagatggaatttcattaaaggataatgttgaaaacttggtggacaaggcaaaggatcag
tttgaaaatcttttgctgtcatcagcatgtgaaactcttatggagattggtaacttagga
aacttgtacattgatgagcaagcaccatggtcttgtttcaagcaagggggtgagagtgct
gaaaaggcagcgaaggatcttgttattattttggagactatgagaataattgcaattgca
ctatcaccgatcaccccaagcctttctttgaggatttatacacagcttggtttcacagaa
gaccaatttagaacattgagatgggaggataccaaatggggaggtctaaaggcaggtcag
gtaatgatggagccaaagccagtttttgcaaggatagaaacagagacggacgagaaagat
caatcaagttcgaaggcaacaaaaggcgggaagaagaaggcaagaagtcaaggacttgtg
gaagcatga

DBGET integrated database retrieval system