KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332718Help
Entry
4332718           CDS       T01015                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4332718
Membrane trafficking [BR:osa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    4332718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 4332718
NCBI-ProteinID: XP_015631338
Position
3
AA seq 1835 aa AA seqDB search
MDSAAAAGEGQRFKRIPRQSLAGNLELDPLLNENLDQWPHLNELVQCYKADFVKDDCKYG
RYESVAPPSFQNQIFEGPDTDLETELQLSNDRQSKPDEVTEDDMPSTSGRQLYETEVPAS
SSKKHCSLSPLPAYEPAFDWENERSLIFGQRVPESVPAINSSGLKITVKVLSLSFQAGLV
EPFSGTICLYNRDRREKLSEDFYFHILPTEMQDAQISLDRRGVFSLDAPSPSVCLLIQLE
KAATEEGGVTPSVYSRKEPVHLTDKEKQKLQVWSRIMPYRESFAWAMIPLFENNQAGGAA
SPSSPLAPSMSGSSSQDSIVEPISKLTLDGKLNHYSSGSSVIVEISNLNKVKESYIEDSL
QDPKRKVHKPVKGVLRLEVEKLHNGHNDMDNISEGGSMANDLNDAGELNNGRYNRSSFDG
IHGSLNSSAVAQKDAHQNGQASNTESGENFQAFDFRMMTRSEPFSQLFHCLYVYPLTISL
GRKRNLFVRVELRKDDSDIRKPPLEAVHPRDRNTTLQKWAHTQIAVGTRMACYHDEVKIS
LPALLTPQHHLLFTFYHVDLQMKPEAPKPVVVGYAVLPLSTHIQLLSDVSLPILRELVPH
YLQESGKERMDYLEDGKTVFRLRLRLCSSLFPVNERIRDFFVEYDRHTLHTSPPWGSELL
EAINSLKNVESTALLQFLQPILNMLLHLIGDGGETLQVAAFRAMVNILTRVQQESSDGAE
RNRFLVSYVDYAFDDFGDRQAPVYPGLSTVWGSLARSKAKGYRVGPVYDDVLAMAWFFLE
LIVKSMGLEQSRLFYHNLPLGEDVPPLQLKDGVFRCIMQLFDCLLTEVHERCKKGLSLAK
RLNSTLAFFCYDLLSIIEPRQVFELVSLYMDKFAGVCQSILHDCKLTFLQIICDHDLFVE
MPGRDPSDRNYLSSVLIQEIFLTLDHDDLSQRAKAARILVVLICKHEFDARYQKSEDKLY
IAQLYFSLIGQILDEMPVFYNLNAVEKREVLVVILQIIRNLDDMTLIKAWQQSIARTRLF
FKLLEECITHFEHNKTGDSLLLGSSSRSPDAERPASPKYSDRLSPSVNAYLSEASRHEIR
PQGTPENGYMWNRVSPQLSSPNQPYSLREALAQAQSSRIGSTARALRESLHPVLRQKLEL
WEENLSTAVSLEVLGIIDKFSVAAASRSITTDYAKLDCVTSVLMGLLSRSQPLAFWKAFL
PVVYNIFNLHGATLMARENDRFLKQIAFHLLRLAVFRNDSIRKRAVVGLQILVRNSFNYF
KNTTRLRVMLTITLSELMSDVQVTQMKSDGSLEESGETRCLRKSLEEMADVRSKDLLKDC
GLPVNALEAAPEGSTDNRWSWVEVKHLSKCLVQALDAGLEHALLGSEMTLDRYAAAEGFY
KLAMAYAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAGVIMQALVGRNDAVWSKEH
VASLCKICPIVNTDVSSEASAAEVEGYGASKLTVDSAVKYLQLANKLFAQAELYHFCASI
QELIIPVYKSRRAYGHLAKCHTSLKDIYESILEQEASPIPFIDATYYRVGFYGERFGKLN
KKEYVFREPRDVRLGDIMEKLSHIYEAKMDGNHTLHIIPDSRQVNADELQPGVCYLQITA
VDPVMEDEDLGSRRERIFSLSTGTVRARVFDRFLFDTPFTKNGKTQGGLEDQWKRRTVLQ
TEGSFPALVNRLLVIKSESLEFSPVENAIGMIETRTAALRNELEEPRSSEGDQLPRLQSL
QRILQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCKRAIRVHFR
LIGEEDQEFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 5508 nt NT seq  +upstreamnt  +downstreamnt
atggattccgcggcggcggcgggggaggggcagcggttcaagcgcattccgcggcagtcg
ttggcggggaacctggagctggatccactgcttaatgaaaatttagatcaatggccacat
ctaaatgagctggttcagtgctataaggctgattttgtgaaagacgactgcaaatatgga
cgatatgaaagtgttgcaccaccatcttttcagaatcaaatttttgagggacctgatact
gacttagaaacagaattgcagcttagcaatgataggcaatccaagcctgatgaagttact
gaagatgatatgccaagcacatcagggagacaattatatgagactgaagtgcccgcttca
tcctcaaaaaaacactgcagtctatcacctttaccagcatatgaaccggcatttgattgg
gaaaatgagagatctttgatattcggccaacgggtgccagaaagtgtccctgcaataaac
agcagtggattgaagataactgtcaaggtgttatctttgtcatttcaagctggattagtt
gagccttttagtggtacaatctgcttgtacaacagagacagaagagaaaaattgtcagaa
gatttctattttcatatactcccaacagaaatgcaagatgctcagatttctctagaccgc
cgaggtgttttttcattggatgccccttcaccatcagtgtgccttctgattcagctagag
aaggctgccactgaggaagggggagtaacaccctctgtttattctcgtaaagaacctgtt
cacttgactgataaagagaagcaaaaattgcaagtctggtctcgaatcatgccatataga
gagtcgttcgcatgggctatgattccactgtttgagaacaaccaggctggtggtgctgcc
tctcccagtagccctctagcaccaagtatgtcaggctcaagttctcaagatagtatagtg
gagcctatttccaagctcactttggatggaaagctcaatcattattcaagtggaagctca
gttattgtagagatatcaaatttgaacaaagtgaaggaaagctacatagaggactccctc
caagaccccaaaagaaaagtacacaaaccagtgaaaggtgtactgaggttagaggtggaa
aaacttcataatggccacaacgacatggataacatttctgagggcggtagcatggccaat
gatttgaatgatgctggtgaactcaataatggtagatacaaccggagtagctttgatggg
atccatggttctttgaattctagtgccgtggcccagaaagatgcacatcagaatggtcaa
gcttccaatacagagagtggtgaaaattttcaagcttttgactttcggatgatgacccga
agtgagccattttcacaactcttccattgtctctatgtgtacccactgactattagcttg
ggccgtaaaagaaatctatttgtaagagtggaattgagaaaggatgattctgacatccgc
aagcctccattagaggctgttcatccaagggatcggaacacaacactacagaagtgggcg
catactcagattgctgttggaacgagaatggcttgctaccatgatgaagttaaaatcagt
ctgcctgctctcttgacaccccaacatcatcttctgttcacattttaccatgtagatctc
caaatgaaacctgaagcccccaaaccagttgtcgtgggatatgctgttcttccactgtcg
acacacattcagttactttcagacgtatctttgccaattttaagagaacttgttccacat
tacctgcaggaaagtggaaaggaaagaatggactatctggaggatggcaaaactgttttt
aggttgcgattaagactttgttcttcattattcccagttaatgaaagaataagagacttt
tttgtcgagtatgaccgccatacacttcatacaagtccaccttggggttctgagcttctt
gaggccataaacagtttaaagaatgttgaatctactgcactgttgcaatttctccaaccc
atacttaatatgctacttcatcttatcggtgatggtggtgaaacccttcaggttgccgca
tttcgagctatggtcaatatcctaacccgggtccagcaggaatcatctgatggggctgag
agaaatcggtttcttgttagttatgttgattatgcttttgatgactttggtgatcggcaa
gcacctgtataccctggtctgtctactgtttggggaagcctggctcggagtaaggctaaa
ggttatagagttgggccagtctatgatgatgtgctggcaatggcttggttttttctggag
cttattgtaaaatcgatgggattggaacaaagtcgtctattttaccataatcttccacta
ggtgaagatgtcccaccgctacagttgaaagatggtgtcttccgatgtatcatgcagctg
tttgattgccttctaactgaggttcatgagcgctgtaaaaagggtttaagcttggcgaag
cgcttgaacagcacacttgctttcttttgttatgatcttctatcaattattgagccacgc
caagtttttgagctggtttcattgtatatggacaagtttgcaggagtttgccagtcaatt
ctccatgattgcaaattgacattccttcagataatatgtgaccatgatctttttgttgag
atgcctggtcgtgacccctctgatagaaattatctctcgtcagtacttattcaagagatt
tttctcacccttgaccatgatgatctatctcagcgagcgaaagcagcccgtattttggtt
gttctaatatgcaagcatgaatttgatgcacgatatcaaaaaagtgaagacaagctgtat
attgctcagctgtatttttctcttataggacagattctagatgagatgcctgtattctat
aatctaaatgctgttgaaaagcgtgaggtgctggtagtcattttgcaaatcataaggaac
ttggacgacatgactctgatcaaagcatggcaacagagcattgctagaaccagattgttc
ttcaagctacttgaagaatgcattacccattttgagcacaacaaaacaggagacagcttg
ttactaggctcaagttcacggagccctgatgctgagcgccctgcatctccaaagtactcc
gatcgattatccccatcagttaatgcatatttgtctgaggcatcacgccatgaaataagg
cctcagggaacaccagaaaatggatacatgtggaacagggttagtcctcaactgagctct
cctaaccagccctattcattgagagaagcacttgctcaagcgcagtcttcaaggattgga
tcaaccgcgagggcactgagagaatctctacatccagtgctgagacaaaagttggaactg
tgggaagaaaatctcagtactgctgtgagcctggaagtgttgggaataattgataagttt
tcagtcgctgcagcttctcgtagcatcactactgattacgcaaagctagattgtgtaaca
tctgtattaatgggtcttttatcaaggagccagcccttagctttttggaaagctttcctt
cctgtggtgtataatatatttaacctccatggcgcaacactgatggcaagggagaatgat
cgcttcttgaagcaaattgcttttcatcttttgcgccttgctgttttccggaatgattct
attagaaaaagggctgttgttgggttgcagattcttgttaggaactcgtttaattatttt
aagaacaccacaaggttgagggtgatgttgacaatcactttgtcagaacttatgtctgat
gtgcaagtaactcagatgaaatctgatggctctcttgaggaaagtggtgaaactcggtgc
cttaggaaatcactagaggaaatggctgatgtacgaagtaaggatctcttgaaagattgt
ggcctccctgttaatgcactggaggcagcgcctgaagggtcgactgataataggtggtct
tgggtagaagttaaacatctatccaaatgtctagtccaggcccttgatgctggtcttgaa
catgccctcttgggctctgaaatgactctggacaggtacgctgctgctgagggtttctat
aagctagcaatggcctacgcgcctgtgccagatcttcatataatgtggttactgcatcta
tgtgatgcacatcaggagatgcaatcatgggctgaagctgcacaatgtgcagttgctgta
gctggtgttatcatgcaggcacttgttggaaggaatgatgcggtgtggagtaaggagcat
gttgcttccctatgtaagatttgccctattgtgaacactgatgttagctcagaagcatct
gcagcagaagttgagggatatggtgcatccaagcttactgtggattcagctgtcaagtat
cttcagctggcaaacaaactttttgcacaagccgaactctatcacttttgtgctagtatt
caggaactcatcattcctgtgtataaaagcagaagggcatatgggcatctggctaagtgt
catacatcactcaaggatatctatgagtcaattcttgaacaggaggctagtcctatacca
ttcattgatgctacctactaccgggtagggttttatggggagcggtttggcaaactcaac
aaaaaggagtatgtgttcagagagccaagagatgttcgtcttggtgacataatggagaag
cttagtcatatctatgaggctaaaatggatggcaatcacaccttacacatcattccggat
tcgagacaagtcaacgctgatgagttgcaacctggtgtctgctatctgcagataactgct
gttgatcctgtaatggaggatgaggacctagggagtagaagggaaaggattttctcttta
tctactggtactgtccgggcccgtgtgttcgaccgttttctttttgatacaccattcaca
aagaatggaaaaacacaaggtggccttgaagatcagtggaagaggcgcacagtactccag
acagagggttcctttcctgctttggtgaatcgtctgttagtgatcaaatcagaatctcta
gagttttctcctgttgagaatgcgattggaatgatcgagacaaggacagctgccttgcga
aatgaactagaagaaccacgcagttcggaaggtgaccaactcccaagactccaaagcctg
cagaggatactccaaggaagtgtggctgttcaggtaaatagtggtgtattaagtgtgtgc
actgcattcttatctggtgagcccgcaactaggctccgatctcaagaactgcagcagctc
atcgctgcattgctggaattcatggccgtctgcaagcgcgcaatccgtgtgcattttaga
ttgataggggaagaagaccaggaattccacactcaactagtcaatggctttcagtcgctc
acagctgagctttcacactatattcctgcaattctttcagagctataa

DBGET integrated database retrieval system