KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332906Help
Entry
4332906           CDS       T01015                                 

Definition
(RefSeq) serine/threonine-protein kinase At5g01020
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 4332906
NCBI-ProteinID: XP_015628221
UniProt: Q10KZ7
Position
3
AA seq 447 aa AA seqDB search
MPPRQWRPMLASATKCCAAEDAVVAVDGSGGGGGLARCRPARSEFSRRLASFRKLSSMTN
SPASSVAGAAEGGKDDGEEGGGGGGGVSGPLQLYSFSFSELRSITHDFSSSYLLGEGGFG
AVHKGFVDAGMRPGLLPQPVAVKQLDIAGLQGHREWLAEVIFLGQFRHPHLVKLLGYCCE
DEERLLVYEFMPRGSLENHLFKRISATVPWGTRLKIAIGAAKGLAFLHGASTPVIYRDFK
ASNILLDSEFTAKLSDFGLAKMGPEGSETHVTTRVMGTHGYAAPEYVMTGHLNIKSDVYS
YGVVLLELLTGRRAMEHVRGRSLHADQVVKIVDWTRPYLGSSRRLRCIMDPRLAGHYSVK
AARAVAHLAVQCTSPQPRDRPRMAAVVDALERLQGFKDMAVTVGLWPTNAPVAGRNAISA
KIRAEVRGAGSGGGAASRRRSASAKLP
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaggcagtggaggccgatgctggcgtcggcgaccaagtgctgcgcggcggag
gacgcggtggtggcggtggatggcagcggcggcgggggcggcctcgcgcggtgcaggccg
gcgcggtccgagttctcacggaggctggcgtcgttccggaagctgtcgtcgatgaccaac
agcccggcgtcgtccgtcgcgggggcggcggagggggggaaagacgacggcgaggagggg
ggcggcggcggtggcggcgtgtccggcccgctgcagctctactccttcagcttctccgag
ctccggtccatcacgcacgacttctccagcagctacctgctcggggagggcggcttcggc
gccgtccacaagggcttcgtcgacgccggcatgcgccccggcctcctgccccagcccgtc
gccgtcaagcagctcgacatcgccggcctccagggccaccgggagtggctggcggaggtg
atcttcttggggcagttccggcacccgcacctggtgaagctgctgggctactgctgcgag
gacgaggagcgcctcctcgtctacgagttcatgccgcgcggcagcctcgagaaccacctc
ttcaagaggatatcggcgacggtgccgtggggcacgcgtctgaagatcgccatcggcgcc
gccaagggcctcgccttcctccacggcgcctccacccccgtcatctaccgcgacttcaag
gcctccaacatcctcctcgactcggagttcacggcgaagctgtcggacttcgggctggcg
aagatggggccggagggttcggagactcacgtgacgacgcgggtgatgggcacgcacggg
tacgcggcgccggagtacgtgatgacggggcacctcaacatcaagagcgacgtgtacagc
tacggcgtcgtgctcctggagctcctgacggggcggcgcgccatggagcatgtcaggggg
aggagcctccacgccgaccaggtggtcaagatcgtcgactggacccgcccctacctcggc
agcagccgccgcctccgctgcatcatggacccgcgcctcgccggccactactccgtcaag
gccgcccgcgccgtcgcccacctcgccgtccagtgcaccagcccgcagccgcgcgaccgc
ccgcgcatggccgccgtcgtcgacgccctcgagcgcctgcagggcttcaaggacatggcc
gtcaccgtcggcctctggcccaccaacgcccccgtcgccggcaggaacgccatctccgcc
aagatccgcgccgaggtcagaggcgccggctccggcggcggcgcggcctcgcggcggcgg
agcgcctccgccaagctgccctga

DBGET integrated database retrieval system