KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333089Help
Entry
4333089           CDS       T01015                                 

Definition
(RefSeq) putative ubiquitin-like-specific protease 1B isoform X1
  KO
K08592  sentrin-specific protease 1 [EC:3.4.22.68]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:osa01002]
    4333089
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4333089
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.68  Ulp1 peptidase
     4333089
Peptidases [BR:osa01002]
 Cysteine Peptidases
  Family C48: Ulp1 endopeptidase family
   4333089
Ubiquitin system [BR:osa04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   4333089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C48
Motif
Other DBs
NCBI-GeneID: 4333089
NCBI-ProteinID: XP_015628740
UniProt: Q75K43
Position
3
AA seq 397 aa AA seqDB search
MSPSATSPPNRPHRKRRAGAGGGGADDGSTRRRGRSAVLLGPTHFPAVRSFGLRLALVVA
PAPRHRRKQRPLHYACRPTSLPCRRRRRLRSIISLLHLPILRPFYLRYILAAAASGPCRC
RRKESLVGMGNYISRVLRKSSSDRGKAPPADDTAKQDLCEVFTPLTNEEESEVNNILYGS
DQSKKIIVMHGPSNIDITKEKIWCLRTCNWLNDEVINLYLELLKERAQREPKRFLKCHFF
NTFFYKKLACGKTGYDYQSVRRWTTLNRLGYGLVECEKIFIPIHRNVHWCLAIINMKDKT
FQYLDSFGGMDHAVLRILARYIRDELNDKSNIQVDTSSWLKISSDSCPLQQNGWDCGMFM
LKFIDFHSRGIGLCFTQEHMDYFRKRTAKEILRLRAD
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtccccctccgccacctcgccgccgaatcgcccacaccgcaagcgccgcgccggtgcc
ggtggcggtggcgctgacgacggctcgacccgccgccgcggccgcagcgctgtcctcctc
ggccccacccacttccccgccgttcgctccttcggcctccgcctcgccctcgtcgtcgcc
ccagccccacgtcaccgccgcaagcagcgcccgctccactacgcctgccgccccacctcc
cttccctgtcgccgccgccgtcgcctccgcagtatcatctccctcctccacctccccatc
ctccgcccgttctacctccgctacatcctcgcggcagccgcatcaggcccctgccgctgc
cgccggaaggaatccctggtaggcatgggaaactacatctcgcgggtgctccggaagagc
tctagtgaccgtggtaaggcgccgccagccgacgatacagccaagcaggatctatgtgaa
gtttttacacctctgacaaatgaagaagaaagtgaagtaaacaacattttgtatggcagt
gatcaaagtaagaaaataatagtgatgcatggaccttccaatattgatattactaaagag
aaaatctggtgcttgagaacttgtaattggttaaatgatgaggtcattaatttgtacctt
gaattgttaaaggagagggcgcaaagagaaccaaaaagatttttgaaatgccacttcttc
aatacattcttttataagaagcttgcttgtggaaaaactggttatgactatcaatctgta
agaagatggacaaccctcaatagattgggctatgggcttgttgagtgtgagaaaatcttt
attccaatacatagaaatgtgcattggtgccttgcgataataaacatgaaggataaaact
tttcaataccttgattcttttggcggcatggaccatgctgtgctgagaatactggctaga
tatatcagggatgaattgaatgacaagagtaacatacaggtagacaccagttcatggctg
aaaatatcatcagattcttgtcctttgcagcagaatgggtgggattgtggtatgtttatg
cttaagttcattgatttccacagtagaggtattggcctatgctttactcaggaacatatg
gattactttaggaaacgaacagcgaaggagatactgagattgagagctgactga

DBGET integrated database retrieval system