KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333310
Entry
4333310           CDS       T01015                                 

Name
(RefSeq) MOB kinase activator-like 1A
  KO
K06685  MOB kinase activator 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB
Motif
Pfam: Mob1_phocein
Other DBs
NCBI-GeneID: 4333310
NCBI-ProteinID: XP_015627873
UniProt: A0A0P0VZH7 Q75G93
Position
3:21108774..21112294
AA seq 214 aa
MSLFGLGRNQKTFRPKKSAPSGSKGAQLRKHIDATLGSGNLREAVRLPPGEDINEWLAVN
TVDFFNQVNLLYGTLAEFCTPESCPTMTAGPKYEYRWADGVQIKKPIEVSAPKYVEYLMD
WIEGQLDDESIFPQKLGTPFPPNFKEVVKTIFKRLFRVYAHIYHSHFQKIVSLKEEAHLN
TCFKHFILFTTEFGLIDKKELAPLQELIESIIPY
NT seq 645 nt   +upstreamnt  +downstreamnt
atgagtctcttcgggctcggccggaatcagaagacgttccgtcccaagaagagtgctcct
tcaggaagcaagggtgcacagcttcggaagcacatagatgccactcttggcagtggaaac
cttagggaagctgtaaggttgccgcctggagaagatatcaatgaatggctggctgtgaat
actgtggatttctttaaccaagttaacctgctgtacggcacactcgctgagttctgcaca
cctgagagctgcccaacaatgactgctggcccaaagtatgagtacagatgggctgatggt
gtacagataaagaagccgatagaagtatcagcaccaaaatatgtggagtacctaatggac
tggattgaaggccaacttgatgatgaatctatatttccccaaaagcttggcacaccattc
ccgccaaacttcaaggaggttgtaaagacaattttcaagcgcttgtttcgtgtttatgcc
cacatatatcactcccattttcagaagattgtcagcctcaaggaggaggcccatcttaac
acgtgcttcaagcacttcatcctgtttacaactgaatttggcctgattgacaagaaggag
ctggctccactccaggagctcatcgaatcgattattccatactga

DBGET integrated database retrieval system