KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334398Help
Entry
4334398           CDS       T01015                                 

Definition
(RefSeq) globulin-1 S allele
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: Cupin_1 Cupin_2 Cupin_3 ARD 3-HAO
Motif
Other DBs
NCBI-GeneID: 4334398
NCBI-ProteinID: XP_015628337
UniProt: Q852L2
Position
3
AA seq 470 aa AA seqDB search
MAKKKTSSSMARSQLAALLISLCFLSLASNAVGWSRRGEREEEDERRRHGGEGGRPYHLG
EESFRHWTRTRHGRFSVLERFPDEQVVGAAVGGYRVAVLEAAPRAFLQPSHYDADEVFYV
KEGEGVIVLLREGRRESFCVREGDAMVIPAGAIVYSANTHSSKWFRVVMLLNPVSTPGHF
EEYFPVGGDRPESFFSAFSDDVLQAAFNTRREELEKVFERQREGGEITTAPEEQIRELSK
SCSRGGGGGSGSEWEIKPSSLTGKSPYFSNNHGKLFELTGDECRHLKKLDLQIGLANITR
GSMIAPNYNTRATKLAVVLQGSGYFEMACPHVSGGGSSERREREREHGRRREEEQGEEEH
GERGEKARRYHKVRAQVREESVIVIPASHPATIVASEGESLAVVCFFVGANHDEKVFLAG
RNSPLRQLDDPAKKLVFGGSAAREADRVLAAQPEQILLRGPHGRGSVSDM
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaagaagacgtcgtcgtccatggcgagatcgcagctggcggcgctgctcatc
tccctgtgcttcctctccctcgcgtcgaacgccgttgggtggagcaggagaggggagcgg
gaggaggaggacgaacggcggcgccacggcggcgagggcgggaggccgtaccacttaggg
gaggagagcttccggcactggacgaggacgcggcacgggcggttcagcgtgctggagagg
ttccccgacgagcaggtggtgggcgccgccgtcggggggtaccgcgtcgccgtgctggag
gcggcgccgcgcgcgttcctgcagcccagccactacgacgccgacgaggtgttctacgtc
aaggagggcgagggcgtgatcgtgctgctgcgtgaggggaggagggagtcgttctgcgtg
agggagggcgacgccatggtcatccccgccggcgccatcgtctactccgccaacacacac
agctccaagtggttccgcgtcgtcatgctgctcaaccccgtctccactcccggccacttc
gaggaatacttccccgtcggcggcgaccggccggagtcgttcttcagcgcgtttagcgac
gacgttctgcaggcggcgttcaacactcgccgggaagaattggagaaggtgttcgagagg
cagcgggagggcggcgagatcacgacggcgccggaggagcagatacgggagctgagcaag
tcgtgctcccgcggcggcggcggcggctcgggttctgagtgggaaatcaagccgtccagc
ctcaccggcaagagtccgtacttctccaacaaccacggcaagctgttcgagctcaccggc
gacgagtgccgccacctcaagaagctcgacctgcagatcggcctcgccaacatcacccgc
ggctcgatgattgcgccgaactacaacacccgcgccaccaagctcgccgtcgtcctgcag
ggcagcggctactttgagatggcgtgcccacacgtgtccggcggcggctcgtcggagcgc
cgggagcgcgagcgcgagcacgggaggaggagggaggaggaacagggagaggaggagcac
ggcgagcgcggggagaaggcgaggaggtaccacaaggtgagggcgcaggttcgggaggag
tcggtgatcgtgatccccgcgtcgcacccggcgacgatcgtcgccagcgagggcgagagc
ctcgccgtcgtctgcttcttcgtcggcgccaaccacgacgagaaggtgttcctcgccggc
aggaacagcccgctgaggcagctcgacgacccggccaagaagctcgtgttcggcggctcc
gcggcgagggaagcggaccgcgtgctcgccgcgcagccggagcagatcttgctgcgcggc
ccgcacggccgcggcagcgtctccgacatgtaa

DBGET integrated database retrieval system