KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334582Help
Entry
4334582           CDS       T01015                                 

Definition
(RefSeq) floral homeotic protein APETALA 2 isoform X1
  KO
K09284  AP2-like factor, euAP2 lineage
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4334582
Transcription factors [BR:osa03000]
 Eukaryotic type
  Other transcription factors
   AP2
    4334582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AP2
Motif
Other DBs
NCBI-GeneID: 4334582
NCBI-ProteinID: XP_015628369
UniProt: Q84TB5
Position
3
AA seq 434 aa AA seqDB search
MLLDLNVESPERSGTSSSSVLNSGDAGGGGGGGGGGGLFRFDLLASSPDDDECSGEQHQL
PAASGIVTRQLLPPPPPAAPSPAPAWQPPRRAAEDAALAQRPVVAKKTRRGPRSRSSQYR
GVTFYRRTGRWESHIWDCGKQVYLGGFDTAHAAARAYDRAAIKFRGLEADINFNLSDYED
DLKQMRNWTKEEFVHILRRQSTGFARGSSKFRGVTLHKCGRWEARMGQLLGKKYIYLGLF
DTEVEAARAYDRAAIRFNGREAVTNFEPASYNVDALPDAGNEAIVDGDLDLDLRISQPNA
RDSKSDVATTGLQLTCDSPESSNITVHQPMGSSPQWTVHHQSTPLPPQHQRLYPSHCLGF
LPNLQERPMDRRPELGPMPFPTQAWQMQAPSHLPLLHAAASSGFSAGAGAGVAAATRRQP
PFPADHPFYFPPTA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgttgttggatctcaatgtggagtcgccggaacggtccggcacgtcgagctcctcggtg
ctaaactccggggacgccggaggcggcggtggcggtggcggtggcggaggattattccgg
ttcgacctcctcgcgagcagccccgacgacgacgagtgctccggggagcagcatcagttg
ccggccgcctcggggatcgtgacgcgtcagctcctcccgcctccgcctcccgcggcgccg
tcgccggcgccggcgtggcagccgccgcgccgcgcggcggaggatgccgccctcgcgcag
cggccggtggtcgcgaagaagacgcggcgcgggccgaggtcgcggagctcgcagtacagg
ggcgtcaccttctacaggaggaccggccgctgggagtcgcacatatgggattgcgggaag
caagtctacctaggtggtttcgacacggcgcacgcggcagcaagggcttacgatcgcgct
gcgatcaagttccggggactggaggctgacatcaacttcaacctgagcgactacgaggac
gatctgaagcagatgaggaactggaccaaggaggagttcgtgcacatactccggcgacag
agcacgggattcgcgagggggagctccaagttccgcggcgtcacgctgcacaagtgcggc
cgctgggaggcacgcatgggccaacttcttggcaagaagtacatataccttgggctcttt
gacaccgaagttgaagctgcaagagcatatgacagggcagctattcgcttcaatgggagg
gaagctgttaccaacttcgagcctgcatcctacaatgtggatgctttaccagacgccgga
aatgaggcaattgttgatggcgatcttgatttggatttgcggatttcgcaacctaatgcg
cgtgactccaaaagcgatgtcgccacaactggcctccagttaacttgtgattcccctgaa
tcttcaaatattacagtccaccagccaatgggctcgtctccccaatggactgtgcatcac
caaagcacaccactgccccctcagcatcaacgtttgtacccatctcattgtcttggcttc
ctcccgaacctacaggagaggccaatggacagaaggcctgagctgggtcccatgccgttc
ccaacacaggcttggcaaatgcaggccccttctcacttgccattgctccacgctgcagca
tcatcaggattctctgccggcgccggcgccggcgtcgccgccgccacccgccggcagccg
ccgttcccggcggatcaccccttctacttcccgccaaccgcctga

DBGET integrated database retrieval system