KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334598Help
Entry
4334598           CDS       T01015                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
osa04141  Protein processing in endoplasmic reticulum
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4334598
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4334598
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4334598
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4334598
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4334598
   03009 Ribosome biogenesis [BR:osa03009]
    4334598
   03110 Chaperones and folding catalysts [BR:osa03110]
    4334598
   04131 Membrane trafficking [BR:osa04131]
    4334598
   03051 Proteasome [BR:osa03051]
    4334598
   03029 Mitochondrial biogenesis [BR:osa03029]
    4334598
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4334598
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     4334598
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    4334598
 Complex C
   Prp19-CDC5 complex
    4334598
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    4334598
Chaperones and folding catalysts [BR:osa03110]
 Heat shock proteins
  HSP70 / DNAK
   4334598
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    4334598
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    4334598
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    4334598
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    4334598
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4334598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 4334598
NCBI-ProteinID: XP_015631367
UniProt: Q84TA1
Position
3
AA seq 649 aa AA seqDB search
MAPTKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAK
NQVAMNPINTVFDAKRLIGRRFSDASVQSDIKMWPYKVIPGPGDKPMIVVQYKGEEKQFS
AEEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE
PTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDF
DNRLVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLFEGVDF
YSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPRVQQLLQDF
FNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVL
IPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQ
ITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHK
KKVDAKNSLENYAYNMRNTIQDEKIASKLPADDKKKIEDAVEQAIQWLDNNQLAEVEEFE
DKMKELEGLCNPIIAKMYQGAGADMGGGMDDDAPAAGGSGAGPKIEEVD
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgaccaagggggaggggccagcgatcggcatcgacctcgggacgacctactcg
tgcgtgggggtgtggcagcacgaccgcgtcgagatcatcgccaacgaccaggggaaccgc
accaccccctcctacgtcgggttcacggacaccgagcgcctcatcggggatgccgccaag
aaccaggtcgccatgaaccccatcaacaccgtcttcgatgccaagcgtcttatcggcaga
cggttttctgatgcctctgtccagagcgatatcaagatgtggccttacaaggttattcct
ggcccaggggataagcctatgattgtagtgcagtacaagggtgaggagaagcaattctct
gccgaagaaatttcatccatggttcttatcaagatgcgtgagatcgctgaagcttaccta
gggtcaactgtgaagaatgctgttgtcactgttcctgcatacttcaatgattcccagagg
caggcaactaaagatgcaggtgttattgcgggtcttaatgttatgcgtatcatcaatgag
ccaacagctgctgcaattgcttatggtcttgacaagaaggcgactagtgttggtgagaag
aacgtgctcatttttgaccttggtggtggtacttttgatgtctccctccttaccattgag
gagggtatttttgaggtgaaagcaacagctggtgacactcaccttggtggggaggacttt
gacaaccgcctggtgaaccactttgtccaagagttcaagagaaagcataagaaggatatc
agcgggaaccccagggctttgaggaggctcagaacatcatgtgaaagggcaaagaggacc
ctctcctccactgcccaaactactattgaaattgattccctctttgagggtgttgatttc
tattccaccatcaccagagccaggtttgaggagcttaacatggacctcttcaggaaatgt
atggagcctgtggagaagtgcctgagggatgcaaagatggacaagagcactgtccatgat
gttgtccttgttggtggttcaactagaatccctagggttcagcagcttctgcaggatttc
ttcaatgggaaggaactctgcaagagcattaaccctgatgaagctgtggcatacggtgct
gccgtccaggctgctatccttagtggagaggggaacgagaaggtgcaggatcttcttctc
cttgatgtgactccactgtctcttggtctcgagacagcgggaggtgtgatgacagtgctc
atcccaaggaacaccaccattcctaccaagaaggagcaggtcttctccacctactccgat
aaccagcctggtgtgttgattcaggtctatgagggtgagaggacacggaccagggacaac
aatctccttggcaaatttgagctgtctggaatccctcctgcccctaggggagtccctcag
atcactgtctgctttgacattgatgccaacggtatcctgaatgtgtctgccgaagacaag
acaactggccagaagaacaagataaccatcacaaatgacaagggaaggctgagcaaagag
gagatagagaagatggttcaggacgccgagaagtacaagtccgaggatgaagagcacaaa
aagaaagttgacgccaagaattccctggagaactatgcttacaacatgaggaacactatc
caagacgagaagattgcttccaagctgccagctgacgacaagaaaaagattgaggacgcg
gtcgagcaggcgatccagtggctggacaacaaccagctcgctgaggttgaagagttcgaa
gacaagatgaaggagctggagggcctgtgcaacccaattattgccaagatgtaccagggt
gctggtgccgacatgggtggtggaatggacgatgatgctccggctgctggtgggagtggt
gctggccctaagattgaggaggtcgactaa

DBGET integrated database retrieval system