KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335789Help
Entry
4335789           CDS       T01015                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 3
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    4335789
   00500 Starch and sucrose metabolism
    4335789
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     4335789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 4335789
NCBI-ProteinID: XP_015635053
UniProt: Q0JDC6
Position
4
AA seq 586 aa AA seqDB search
MATARARAALVFVALLQMAAVVVVRASHVVYPELQSLEAKHVDGKLRTGYHFQPPKHWIN
DPNGPMYYKGLYHLFYQYNPKGAVWGNIEWAHSVSTDLIDWTALEPGIYPSKTFDEKGCW
SGSATVLPSGVPVIMYTGIDPDERQVQNVAYPVNLSDPYLREWYKPDYNPIINPDGGINA
SAFRDPTTAWYGPDGHWRLLVGSKVNMKGLAVLYRSRDFKKWVKAHHPLHSAHTGMWECP
DFFPVAVAGGSRHYRRGVDTAELHDAAVAEEVKYVLKVSLDLTRYEYYTVGWYDHATDRY
VPDAAFPDNDYGLRYDYGDFYASKSFYDPAKRRRIVWGWANESDTVPDDRRKGWAGIQAI
PRKLWLSADGKQLVQWPVEELKALRAKHVNVTDKVIKKGNYFEVTGFKSVQSDVDMAFAI
KDLSKAEEFDPAWRTDAEALCKKLGSDVDGGVGPFGLWALASGDLKERTAVFFRVFKAND
SSHVVLMCNDPTRSSYESKIYRPTFAGFVDVDIAKNKQIALRTLIDHSVVESFGARGKTC
ILTRVYPRKAVGDDAHLFVFNNGESDVKVTNLDAWEMKTPKMNAEE
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggcgagggcgagggccgcgctggtgtttgtggctctgctgcagatggcggca
gtggtggtggtgcgcgcgtcgcacgtcgtctacccggagctccagtcgctggaggcgaag
cacgtcgacgggaagctccggaccgggtaccacttccaaccacccaagcactggatcaac
gatccgaacggtccgatgtactataagggcttgtaccatctgttctaccagtacaacccc
aagggcgccgtgtgggggaacatcgagtgggcgcactcggtttcgacggacctgatcgac
tggacggcgctggagccggggatctacccgtccaagacgttcgacgagaagggctgctgg
tcgggctccgccaccgtgctccccagcggcgtgccggtgatcatgtacaccggcatcgac
cccgacgagcggcaggtccagaacgtcgcctacccggtgaacctctccgacccgtacctc
cgcgagtggtacaagcccgactacaaccccatcatcaacccggacggcggcatcaacgcc
agcgcgttccgcgacccgaccaccgcctggtacgggcccgacggccactggcggctcctc
gtcggcagcaaggtgaacatgaaggggctcgccgtgctgtaccggagccgggacttcaag
aagtgggtcaaggcgcaccacccgctgcactcggcgcacaccgggatgtgggagtgcccg
gacttcttccccgtcgctgtggcgggcgggagccgccactaccgccgcggcgtcgacacc
gccgagctgcacgacgccgccgtggcggaggaggtcaagtacgtgctcaaggtgagcctc
gacctgacgcggtacgagtactacaccgtcggctggtacgaccacgccaccgaccggtac
gtccccgacgccgccttccccgacaacgactacggcctccgctacgactacggcgacttc
tacgcatccaagtcgttctacgacccggccaagcgccgccgcatcgtctggggctgggcc
aacgagtccgacaccgtacccgacgaccgccgaaagggctgggccggcatccaggcgata
ccgaggaagctctggctgtcggcggacgggaagcagctggtgcagtggccggtggaggag
ctcaaggcgctgcgagccaagcacgtcaatgtcactgacaaggtcatcaagaagggcaac
tacttcgaggtcaccggcttcaagtccgtgcagtcggatgtggatatggcgttcgcgatc
aaggacctgagcaaggcggaggagttcgacccggcgtggcggacggacgcggaggcgctg
tgcaagaagctcggctcggacgtcgacggcggcgtggggccgttcgggctgtgggcgctg
gcctccggcgacctcaaggagaggacggccgtcttcttcagggtgttcaaggccaacgac
tcctcgcacgtcgtcctcatgtgcaacgaccctaccaggtcatcgtacgagtcgaagatc
tacaggccgaccttcgccggcttcgtcgacgtcgacatcgccaagaacaaacaaatcgcc
ctccggacattgatcgatcactccgtggtggagagcttcggggcgcgcggcaagacgtgc
atcctgacgagggtgtacccgaggaaagccgtcggcgacgacgcgcacctcttcgtcttc
aacaacggcgagtcggacgtcaaggtcaccaacctggacgcctgggagatgaagaccccg
aagatgaacgcggaggagtag

DBGET integrated database retrieval system