KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335968Help
Entry
4335968           CDS       T01015                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP53
  KO
K14826  FK506-binding nuclear protein [EC:5.2.1.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:osa03009]
    4335968
Enzymes [BR:osa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     4335968
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    4335968
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C NPL
Motif
Other DBs
NCBI-GeneID: 4335968
NCBI-ProteinID: XP_015633396
UniProt: Q7XUX5
Position
4
AA seq 525 aa AA seqDB search
MSSFWGAEVKPGKPYTHTHIPRLGRLRLTQATLGGEAGKVEKGGGGKKNVVQLQCTVKNK
DPVFLCALVPGQSETCHLELEFEEKHVTFSVLGPRSVHLAGYYIGDVYGEEIDDSDTGSD
SLQGSDDDAFLDTDDDDSGADDGTVLIPLSPGNSDGEDDDSEYDSEDDDSEMIYNQRRGK
SSVVIEEIQEDDKPAAGGAQKGSNKKQTSENGDDSKLQLVVRTPPAESLESEDEDGFPVS
FSESKKRTDGSSKKKGNLNNKMSTEDRKRKSSAVGDHHDPSGEVKDENDGVSKKNKKAKA
KKTAVGGVEKEIKQEDSPADLVDAKQKKNKNKNTSEAEAGAHQNTDKTKHIHTDAEEDTA
QEASKKKKNKKKKTQEKNESENQTPKTQEKNAKGNQTSNTDLTGSESKKQPLQTRTFGNG
MIIEEIEMGKPDGKKASPGKKVSVKYIGKLKNGTIFDSTVGRRAFDFRLGIGEVIKGWDI
GINGMRVGDKRRLTIPPSMGYGNKRMGPIPQNSTLVFDVELVNVK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgttttggggcgcggaggtgaagcccgggaagccctacacccacacccacatc
ccgcgcctcggccgcctgcgcctcacccaggcgacgcttggaggggaggctgggaaggtg
gagaagggcggcggtgggaagaagaacgtggtgcagttacagtgcactgtgaagaacaag
gatcccgtgttcctgtgtgccctggtgccggggcagtcggagacttgccacctggagctc
gagttcgaggagaagcacgtcacgttctcggtgctcgggccgaggagcgtccacctcgct
ggatactacattggtgatgtgtatggggaggagatagatgacagtgatactggtagtgac
tctctgcaaggctcagatgatgatgcttttctggatactgatgatgatgacagtggcgct
gatgatggcactgttctcatcccattatctcctggaaactcagatggtgaagatgatgat
tcagagtatgactcagaggatgatgactcagagatgatatacaatcagcgtagaggcaaa
agttcagttgttattgaggaaattcaagaggatgacaagcctgctgctggtggagcacaa
aagggatcaaacaagaagcaaaccagcgaaaatggtgatgattctaaactgcagcttgtt
gttaggactccacctgctgaatctttggaaagcgaagatgaagatggctttcctgtatca
ttttctgaatcaaagaaaagaactgatggtagttctaagaaaaaaggcaacctaaacaac
aagatgagcactgaagataggaaaaggaaaagcagtgctgttggcgaccatcatgaccct
tcaggggaagtaaaggatgaaaatgatggagtgtcaaagaaaaataaaaaggccaaggcc
aaaaagactgctgtgggcggtgtggaaaaggagatcaaacaggaagattctccagctgat
cttgttgatgcaaaacaaaagaaaaacaagaacaaaaatacctcagaagcagaagctggt
gctcatcagaataccgataagacaaaacatatccacactgatgctgaggaagacactgca
caggaggctagcaaaaagaaaaagaacaagaaaaagaagacacaggagaagaatgaaagt
gagaaccagacaccaaaaacacaggagaagaatgctaaaggaaaccagacatcaaataca
gatcttacggggtcagagagcaagaagcagccgctccaaacacgcacttttggcaatggt
atgataattgaggagatagaaatgggcaaaccagatggtaaaaaagcctctcctgggaaa
aaggtttctgttaaatacattggcaagctaaagaatggcacaatttttgactctacggtt
ggtcgaagggcatttgattttagactcggtattggggaggtcattaagggctgggatata
ggcatcaatggtatgcgtgttggggacaaaaggaggctcacgatcccaccatcaatgggg
tatggaaacaaaagaatggggccaataccgcagaactcaaccctcgtgtttgatgtggaa
ctcgtgaatgtaaagtga

DBGET integrated database retrieval system