KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336037Help
Entry
4336037           CDS       T01015                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4336037
   00052 Galactose metabolism
    4336037
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     4336037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 4336037
NCBI-ProteinID: XP_015636913
UniProt: A0A0P0WB27
Position
4
AA seq 380 aa AA seqDB search
MARPAPLLLLLAAVCLVAAASAGGADAAERKATTVGVYELRKGDFSIRVTNWGAVIMSVV
LPDSRGKLDDVVLGYDTIAEYVNSSTYFGALVGRVANRIAKARFVLDGKAYHLYPNDGKN
TLHGGHRGFSNVTWTVKEHVGGGDAPYITLYYHSFDGEQGFPGALDVYVTYQLSGPYVLS
VHMNATAAGKATPVNLAQHSYWNLGGTGSGDILGNTVQLFASRYTPVDAELIPTGQVAPV
TGTPYDLRAPTPVGARVHLVTGGLSKTGATIYGFDTNYAVDGGDDVDAHAHALRRVTVVR
DGKSGRSLELWANQPGVQFYTGNFLTADVKGKGGKAYGQYGALCLETQGFPDAVNHPNFP
SVIVRPGQVYKHEMVYKFSF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggctagaccagctccgctgctgcttcttctcgcggcggtgtgcctagtggccgccgcc
tccgccggcggtgccgatgcggcggagaggaaggcgacgacggtcggcgtctatgagctc
aggaagggagatttctccatcagggtcaccaattggggagcggtcatcatgtccgtcgtg
cttcctgactccagagggaaattggacgatgttgttcttggatatgacaccattgctgaa
tatgttaattcttctacttactttggagcgctcgtcggacgggtagccaacagaattgcc
aaggcgcggttcgtgctcgatggaaaagcttatcatctgtatccaaatgatggcaaaaac
acacttcacggtggtcacaggggtttcagcaatgttacatggacagtgaaggagcatgtt
ggtggaggtgacgcaccatacatcacactgtactaccatagctttgacggagaacaagga
ttcccaggcgccctagacgtgtacgtgacgtaccagctgtccggcccgtacgtgctgagc
gtgcacatgaacgcgacggcggcgggcaaggcgacgccggtgaacctggcgcagcactcg
tactggaacctcggtggcacgggcagcggcgacatcctgggtaacacggtgcagctgttc
gcgtcgcggtacacccccgtggacgccgagctcatcccgacgggccaggtcgcgcccgtc
accggcacgccctacgacctccgcgcgccgacgcccgtgggcgcgcgcgtccacctggtg
acgggcggcctcagcaagacgggcgccaccatctacggcttcgacaccaactacgccgtg
gacggcggtgacgacgtcgacgcgcacgcgcacgcgctgcggcgggtgaccgtcgtccgg
gacggcaagtccgggcggtcgctggagctgtgggcgaaccagcccggggtgcagttctac
accggcaacttcctcacggccgacgtgaaggggaagggcgggaaggcgtacgggcagtac
ggcgcgctgtgcctggagacgcaggggttccccgacgccgtgaaccaccccaacttcccg
tcggtgatcgtgaggcccggacaggtgtacaagcacgagatggtgtacaagttctcgttc
tag

DBGET integrated database retrieval system