KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337635
Entry
4337635           CDS       T01015                                 
Name
(RefSeq) UPF0014 membrane protein STAR2
  KO
K02069  UDP-glucose/iron transport system permease protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:osa02000]
    4337635
Transporters [BR:osa02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   UDP-glucose/iron transporter
    4337635
SSDB
Motif
Pfam: UPF0014 DUF3112
Other DBs
NCBI-GeneID: 4337635
NCBI-ProteinID: XP_015637768
UniProt: Q5W7C1
Position
5:989403..990803
AA seq 285 aa
MMASMAALLQRLLVVVNQVDPGAPGFWREFLVGMLKPVAATAVVAMAVALSFTQRLGLEG
EMLYAMARAFLQLSVIGFVLQFIFTQKSAAWILLAYLFMVTVAGYTAGQRARHVPRGKHI
AAVSILAGTSVTMALLVALRVFPFTPRYIIPVAGMMVGNAMTVTGVTMKKLREDVGMQRG
VVETALALGATPRQATARQVRRSLVIALSPVIDNAKTVGLIALPGAMTGLIMGGASPLEA
IQLQIVVMNMLMGASTVSSILSTYLCWPAFFTGAFQLNDAVFAAD
NT seq 858 nt   +upstreamnt  +downstreamnt
atgatggcgagcatggcggcgctgctgcagcgtctgctggtggtggtgaatcaggtggac
ccgggcgcgccggggttctggcgggagttcttggtgggcatgctgaagccggtggcggcg
acggcggtggtggcgatggcggtggcgctgagcttcacgcagcggctggggctcgagggc
gagatgctgtacgccatggcgcgggcgttcctccagctctccgtcatcggcttcgtcctc
cagttcatcttcacccagaagagcgccgcctggatcctcctcgcctacctcttcatggtc
accgtcgccggctacaccgcggggcagcgcgcccgccacgtcccgcgggggaagcacatc
gccgccgtctccatcctcgccggcacctccgtcaccatggccctcctcgtggcgctccgg
gtgttcccgttcacgccgcggtacatcatcccggtggccgggatgatggtcgggaacgcg
atgacggtgaccggggtgacgatgaagaagctgagggaggacgtggggatgcagcgaggg
gtggtggagacggcgctggcgctgggcgcgacgccgcggcaggcgacggcgcggcaggtg
aggaggtcgctggtgatcgcgctgtcgccggtgatcgacaacgccaagacggtggggctg
atcgcgctgccgggcgccatgaccggcctcatcatgggcggcgcgtcgccgctggaggcc
atccagctgcagatcgtggtgatgaacatgctcatgggcgcttccaccgtcagcagcatc
ctctccacctacctctgctggccggccttcttcaccggcgccttccagctcaacgacgcc
gtcttcgccgccgactaa

DBGET integrated database retrieval system