KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337723
Entry
4337723           CDS       T01015                                 

Name
(RefSeq) probable protein phosphatase 2C 47
  KO
K14803  protein phosphatase PTC2/3 [EC:3.1.3.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4337723
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:osa03009]
    4337723
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     4337723
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    4337723
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-40S particles
   Other pre-40S particles
    4337723
SSDB
Motif
Pfam: PP2C PP2C_2
Other DBs
NCBI-GeneID: 4337723
NCBI-ProteinID: XP_015640687
UniProt: Q6AUQ4
Position
5
AA seq 389 aa
MVAEAEVMHQPVPVLEVPYHRCVAKGVEEVAAAAAVAPPPVVEVEVAVQVPHMGLESAAG
APSISVDALQFVPSIRSGSFADIGPRRYMEDEHIRIDDLSAHLGSLLVCPLPSAFYGVFD
GHGGLDAAAYMKRHAMRFLFEDSEFPQASQVDETYVQSVENSVRRAFLQADLALADDLDI
SRSSGTTALTALVFGRQLLVANAGDCRAVLCRRGVAMEMSRDHRANYAEECERVAASGGY
IEDGYLNGVLSVTRALGDWDMKMPDGSISPLIAEPEFRQTMLTEDDEFLIMGCDGIWDVM
TSQHAVSIVRRGLRQHDDPERCARELVMEAKRLETADNLTVIVVCFVSELGSPRQEQVGG
QAGVARPRSCKSLSAEALCNLRSWLETDR
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggtggcggaggcggaggtgatgcatcagcccgtgccggtgttggaggtgccgtaccac
cggtgcgtcgccaagggtgtcgaggaggtggccgccgcggcggcggtcgcgccgccgccg
gtggtcgaggtcgaggttgccgtccaggtgcctcacatggggttggagagtgctgctggt
gcaccgagcatatcagttgatgcactacagtttgttcccagtattcgatctggtagcttt
gctgatattggacctaggaggtacatggaagatgagcacatccggatagatgatctctct
gcccatcttggatcgctcttggtgtgtccgttgcctagtgccttctatggggtcttcgat
ggccatggaggcctggatgctgcagcctacatgaaaaggcatgcaatgaggttcctgttt
gaggacagtgagttcccacaagcatcgcaagtagatgaaacatatgttcagtcagttgag
aactctgtgcgcagagcgttcttgcaagcagatcttgccttagctgatgatttagatatc
agccgctcttccggaactacagcactcaccgcattagtcttcggaaggcaattgctggtt
gcaaatgcgggggattgccgtgcggtcctttgccggagaggcgtagcgatggagatgtct
cgagatcacagagcaaactatgccgaggagtgtgaacgggttgctgcatccggaggatac
atcgaggatggctacctcaacggagtcctatccgtgacacgggccctaggggactgggac
atgaaaatgcccgacggctcgatatcccctctcatcgccgagccagagttccgacagacc
atgctcacggaggacgacgagttcctcatcatggggtgcgacgggatctgggacgtgatg
accagccagcacgcggtgagcatcgtccgacgggggctccggcagcacgacgaccccgag
aggtgcgcgagggagcttgtcatggaggccaagaggctcgagaccgccgacaacctgacg
gtgatcgtcgtctgcttcgtctcggagcttgggtcgccgcggcaggagcaggtggggggg
caggcgggggtggcgaggccgaggagttgcaagagcctctctgcggaggccctgtgcaac
ctgaggagctggctggagactgatcgctag

DBGET integrated database retrieval system