KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338718Help
Entry
4338718           CDS       T01015                                 

Definition
(RefSeq) chitinase 2
  KO
K20547  basic endochitinase B [EC:3.2.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4338718
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4338718
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     4338718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_19 Chitin_bind_1
Motif
Other DBs
NCBI-GeneID: 4338718
NCBI-ProteinID: XP_015640432
UniProt: Q7DNA1
Structure
PDB: 

Position
5
AA seq 340 aa AA seqDB search
MSTPRAAASLAKKAALVALAVLAAALATAARAEQCGAQAGGARCPNCLCCSRWGWCGTTS
DFCGDGCQSQCSGCGPTPTPTPPSPSDGVGSIVPRDLFERLLLHRNDGACPARGFYTYEA
FLAAAAAFPAFGGTGNTETRKREVAAFLGQTSHETTGGWPTAPDGPFSWGYCFKQEQNPP
SDYCQPSPEWPCAPGRKYYGRGPIQLSFNFNYGPAGRAIGVDLLSNPDLVATDATVSFKT
ALWFWMTPQGNKPSSHDVITGRWAPSPADAAAGRAPGYGVITNIVNGGLECGHGPDDRVA
NRIGFYQRYCGAFGIGTGGNLDCYNQRPFNSGSSVGLAEQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgccgagagcggcggcgagcctcgccaagaaggcggcgctggtggcgctggcc
gtcctggccgcggcgctcgcgacggcggcgcgcgccgagcagtgcggcgcgcaggccggc
ggcgccaggtgcccgaactgcctctgctgcagccgctggggctggtgcggcaccacctcc
gacttctgcggcgacggctgccagagccagtgcagcggctgcggcccgacgccgacgccg
acgccgccgagcccctccgacggcgtgggctccatcgtgcccagggacctgttcgagcgg
ctcctcctccaccgcaacgacggggcgtgccccgcgcgcgggttctacacctacgaggcc
ttcctcgccgccgccgccgcgttcccggcgttcggcggcaccggcaacaccgagacgcgg
aagcgggaggtcgccgcgttcctgggccagacctcccacgagaccaccggcgggtggccg
accgcgcccgacggccccttctcctggggctactgcttcaagcaggagcagaacccgccg
tccgactactgccagccctcgccggagtggccgtgcgcccccggccgcaagtactacggc
cgcggccccatccaactctccttcaacttcaactacgggccggcggggagggcgatcggg
gtggacctgctgagcaacccggacctggtggcgacggacgcgacggtgtcgttcaagacg
gcgctgtggttctggatgacgccgcaggggaacaagccgtcgagccacgacgtgatcacg
gggcggtgggcgccctcgccggccgacgccgcggcggggcgggcgccggggtacggcgtg
atcaccaacatcgtcaacggcgggctggagtgcgggcacggccccgacgaccgcgtggcg
aaccggatcggcttctaccagcgctactgtggcgcgttcggcatcggcaccggcggcaac
ctcgactgctacaaccagaggccgttcaacagcggctcgtcggttgggttggcggagcag
tga

DBGET integrated database retrieval system