KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339168Help
Entry
4339168           CDS       T01015                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    4339168
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:osa03036]
    4339168
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     4339168
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     4339168
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 4339168
NCBI-ProteinID: XP_015639838
UniProt: Q6F322
Position
5
AA seq 672 aa AA seqDB search
MDRASNFIPGPYQELVDAKPIRSLAPMFPAPLGINVNQSSTPPLVCVTPVGQFPVGFGSG
ILPTFGSTTAFTTTANGVSYTSYTNNGAIDATPISAYKTRPGIVSLDGDEPYSGSASGRK
SKRSSGSAADGSNGVKFKRPKPVYKNFVAGKELAFLPPSSSDPREVVEAVHMTFEALRRR
HLQLDEIQETSKRADLKAGAIMMASNIRANVGKRVGLVPGVEIGDIFYFRMELCIIGLHA
PSMGGIDYMSAKFGSDEDSVAICIVAAGGYENVDDDTDTLVYSGSGGNSRNSEERHDQKL
ERGNLALERSLHRKNEIRVVRGFRDPFCLTGKIYIYDGLYKIQESWKERTKSGINCFKYK
LLREPGQPDGAALWKMTQGWIDNPASRGRVILPDLSSAAEALPVCLVNEVDHEKGPGHFT
YASQVKYLRPLSSMKPLQGCGCQSVCLPGDPNCACGQHNGGDLPYSSSGLLACRKPIIYE
CGDACHCTTNCRNRVTQKGVRFHFEVFRTANRGWGLRCWDPIRAGAFICEYTGEVIDELK
VNLDDSEDDYIFQTVCPGEKTLKFNFGPELIGEESTYVSADEFEPLPIKISAKKMGNVSR
FMNHSCSPNVFWQPVQHDHGDDSHPHIMFFALKHIPPMTELTFDYGVAGSESSGSRRTKN
CFCGSSNCRGVF
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggatagggcgtcgaatttcatacctggtccttatcaagaactcgtggatgccaaacca
attagatcgttagctcctatgttccctgcacccttgggaatcaatgtcaaccagtcaagc
accccgcctttggtatgtgtcactccggttggccaatttcctgtcggttttggttctgga
atccttcctacctttggttcaactactgccttcactaccacagcaaatggggtttcttat
acaagctacaccaataatggagctattgatgccactcctatctcggcatataagaccaga
ccaggcattgtatcacttgatggcgatgaaccttactcaggttcagcatctggacggaag
tccaagagatcatctggttcagctgctgatggttcaaatggagttaagttcaagcgccct
aagccagtttacaagaattttgttgctggcaaggagcttgcctttttaccaccttcatcc
agtgatcccagggaggttgtggaagcagtccacatgacctttgaagcacttaggcgtaga
catctgcaactggatgaaatacaagagactagcaaacgggctgacctgaaggctggcgcc
atcatgatggcaagcaatatcagggctaatgtgggaaaaagggtaggacttgttcctgga
gttgaaataggggatattttctatttccggatggagctatgtatcatcgggttgcatgct
cctagtatgggtggcattgattatatgagtgctaaatttggaagcgatgaggattctgtg
gcaatatgtattgttgcagcaggtggctatgagaatgtggatgatgacacagatacactg
gtgtacagtggttcaggtggcaatagtaggaacagtgaggagaggcatgatcaaaagctt
gagagaggtaaccttgctctggagaggagcctgcataggaagaacgagatcagggttgtg
cggggcttcagggatccattttgcctgactggaaaaatctacatatatgatggcctctat
aagattcaggagtcctggaaggagagaacaaagtctggtatcaattgcttcaagtacaaa
ctgctgcgtgagcctggacagcctgatggagctgcattgtggaagatgactcaaggatgg
atagacaatccagcaagcagaggcagggttatattacctgatctatcatctgcggctgaa
gctctcccagtttgccttgtcaatgaggtagaccatgagaaaggacctgggcatttcacc
tatgccagtcaagtcaaatacttgaggcccctcagttctatgaaacccttacagggttgc
ggatgccagagtgtttgcctgcctggtgatcccaactgtgcttgtggacaacataacgga
ggtgacttaccttacagctcatcaggacttttggcgtgccgcaagccaataatttatgaa
tgcggtgatgcttgccattgtactacgaattgccggaacagagtgacccaaaaaggggtc
agatttcactttgaggtcttccggactgcaaatcgaggctggggtcttcgctgctgggat
cccattcgtgctggtgcatttatctgtgagtatactggtgaggtcattgatgagctcaaa
gttaatctggatgacagtgaagatgattacatttttcagactgtatgtcctggtgagaag
acattaaaattcaactttggtcctgaattgattggtgaggagagtacatatgtatcagct
gatgaatttgagccactgcccatcaagattagtgcaaaaaagatgggaaatgtctcacgt
ttcatgaaccatagttgttccccgaatgttttctggcagccagttcagcatgaccatgga
gatgacagccacccacatatcatgttctttgcactgaagcacattcctcccatgacagaa
ctgacttttgactatggtgttgctggatctgagtcttcaggttctcgtagaactaagaac
tgcttttgtggatcatcaaactgccggggagtattttaa

DBGET integrated database retrieval system