KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339369Help
Entry
4339369           CDS       T01015                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 6
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00052  Galactose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
osa03018  RNA degradation
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4339369
   00030 Pentose phosphate pathway
    4339369
   00051 Fructose and mannose metabolism
    4339369
   00052 Galactose metabolism
    4339369
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    4339369
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     4339369
Protein phosphatases and associated proteins [BR:osa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     4339369
Messenger RNA biogenesis [BR:osa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     4339369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-GeneID: 4339369
NCBI-ProteinID: XP_015639708
UniProt: Q65X97
Position
5
AA seq 567 aa AA seqDB search
MASSHIILPPDDDDEEQRRLEEEEDEDPWARSGPPPAAPEHAMKAALPFSATCVRISRDS
YPNLRALRNASSVSLADAAYVKISEGDFGYVLDDVPHLVDHLPDAPTYPNPLQDHPAYST
VKQYFVNEDDTVPQKVVVQKNSRRGVHFRRAGPRQKVYFESDEVKACIVTCGGLCPGLNT
VIRELVCGLAHMYNVSKIYGIQNGYKGFYSSNYLTLTPKSVDDIHKRGGTVLGTSRGGHD
TKKIVDNIQDRGINQVYIIGGDGTQKGAYEIFKEIRKRGLKVSVAGIPKTIDNDIAIIDK
SFGFDTAVEEAQRAIDSAHVEACSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPE
SPFYMDGEGGLLQYVERRLKENKHMVIVVAEGAGQDLIAKSLSTSEQQDASGNKLLLDIG
LWLTHKIKDHFKSKKMEMTIKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYSFT
VGNVNGRHAYIPFYRVTSTRNKVKITDRMWARLLSSTNQPSFLSQKDIDEAKENDRTANK
PPLPTGLSHHVANSFDQSASSSSNSQI
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctcccacatcatccttccgccggacgacgacgacgaggagcagcgccggctg
gaggaggaggaggacgaggatccgtgggcgcggagcgggcctccccccgcggcgccggag
cacgcgatgaaggcggcgctgccgttctccgcgacgtgcgtgcggatctcccgcgactcc
taccccaacctccgcgccctccgcaacgcctcctccgtcagcctcgccgacgccgcctac
gtgaagatctccgagggggacttcggctacgtcctcgacgacgtgccgcacctcgtcgac
cacctccccgatgcccccacttatcccaatccactacaagatcatccagcctattcaact
gtcaagcaatattttgttaatgaagatgacactgtaccccaaaaggtggtcgttcagaag
aacagccggcggggggttcacttccgtcgtgctggacctcgtcagaaggtttattttgag
tcagatgaagtgaaagcatgcattgtaacttgtggaggcctttgccctggtcttaacact
gtcatcagagagctcgtctgtggtttggcgcacatgtataatgtcagcaaaatctatggt
atacagaatggatacaagggcttctattctagcaattaccttactctgacgccaaagagt
gtcgatgacatccacaagaggggtgggacagttcttggcacatcacgaggtggccatgat
acaaaaaagattgttgacaacattcaggatcgtggaattaatcaggtctatatcattgga
ggagatggaacacagaagggtgcatatgagatcttcaaggaaatccgaaaacgtgggcta
aaggtttctgttgctgggattcccaagacaatagataatgacatagcgatcattgacaag
tcatttggttttgatacggccgtagaagaggcccagcgtgccattgattcagctcatgtg
gaagcttgcagtgctgagaatggaataggcttagtaaaactgatgggccgttatagtggg
ttcattgcaatgtatgctactcttgcaagtcgagatgtggactgctgcttaattccagag
tccccattttatatggatggtgaaggtgggttgcttcaatatgtagagagaaggctgaaa
gagaacaagcacatggttattgttgttgctgagggagcagggcaggatcttatagccaaa
agtttatctacttctgagcagcaagatgcatcaggaaataagctactgcttgatattggt
ctttggctgactcacaagataaaggaccacttcaagagcaaaaagatggagatgactatt
aaatatatagatcctacctacatgatccgagctattccaagcaatgcatcagacaatgtc
tactgcacgctgctggcccacagtgctattcatggtgcaatggccggctatagcttcact
gttggaaatgtcaacggcagacatgcctacatacctttctatagggtgacatccacacgg
aacaaggtcaagatcactgataggatgtgggcgaggctgctatcatcaaccaaccagcca
agcttcctaagccagaaggacatcgacgaagccaaagagaacgataggacggccaacaag
ccaccacttcccaccggcctcagccatcatgtggcaaactctttcgaccagtctgcatca
tcttcgtcgaacagccagatatga

DBGET integrated database retrieval system