KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339521Help
Entry
4339521           CDS       T01015                                 

Definition
(RefSeq) threonine synthase, chloroplastic
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00750  Vitamin B6 metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4339521
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    4339521
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     4339521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 4339521
NCBI-ProteinID: XP_015640529
UniProt: Q6L4H5
Position
5
AA seq 521 aa AA seqDB search
MAATTHAASLSFLLSHPHPTSPNPNPNPNLPLRRAPHRVRCATDAAATRHRRAADENIRE
EAARHRAPNHNFSAWYAPFPPAPNGDPDERYSLDEIVYRSSSGGLLDVRHDMDALARFPG
SYWRDLFDSRVGRTTWPFGSGVWSKKEFVLPEIDPDHIVSLFEGNSNLFWAERLGRDHLA
GMNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRRAPLSRPIAGVGCASTGDTSAALSAY
CAAAGIPAIVFLPANRISLEQLIQPIANGATVLSLDTDFDGCMRLIREVTAELPIYLANS
LNSLRLEGQKTAAIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRVLGLVDRVPRL
VCAQAANANPLYRYYKSGWTEFTPQVAEPTFASAIQIGDPVSVDRAVVALKATDGIVEEA
TEEELMNAMSLADRTGMFACPHTGVALAALFKLRDQRIIGPNDRTVVVSTAHGLKFSQSK
IDYHDSKIEDMACKYANPPVSVKADFGAVMDVLKKRLKGKL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaccacccacgccgcctccctctccttcctcctctctcacccccaccccacc
tcccccaaccctaaccctaaccctaacctccccctccgccgcgccccccaccgcgtccgc
tgcgccaccgacgccgccgccaccaggcaccggcgcgcggccgacgagaacatccgggag
gaggcggcgaggcaccgcgccccgaaccacaacttctccgcgtggtacgcgcccttcccg
cccgcccccaacggcgaccccgacgagcgctactccctggacgagatcgtctaccgctcc
agctcgggcggcctcctcgacgtgcgccacgacatggacgcgctcgcccgcttcccgggc
tcctactggcgcgacctcttcgactcccgcgtcggccgcaccacctggcccttcggctcc
ggcgtctggtccaagaaggagttcgtcctccccgagatcgaccccgaccacatcgtctcc
ctcttcgagggcaactccaacctcttctgggcggagcgcctcggccgcgaccacctcgcc
gggatgaacgacctctgggtcaagcactgcggcatctcccacaccggatcgttcaaggat
ctcggcatgacggtgctcgtcagccaggtgaaccgcctccgccgcgcgccgctctcccgc
cccatcgccggagtcgggtgcgcctccacgggggacacctccgccgcgctctcggcctac
tgcgccgccgcggggatcccggccattgtgttcctccccgccaaccgcatctcgctcgag
cagctcatccagcccattgccaatggcgccaccgtgctctcgctcgacacggacttcgac
ggctgcatgcggctcatcagggaggtgactgccgagctgccgatttaccttgcgaattca
ttgaattcccttcggctcgaggggcagaagactgctgctattgagattcttcagcagttc
gattgggaggtgccggattgggtcattgttcccggaggcaatcttgggaacatatatgcc
ttctacaagggattcgagatgtgccgcgtccttgggctcgtcgatcgtgtgccgcggctt
gtctgcgcgcaggctgccaatgcgaacccgctgtaccggtactacaagtcggggtggact
gagttcacgccgcaggtggctgagccgacatttgcatcggcaattcagattggtgacccg
gtatctgtcgatcgcgcggtggttgcgctcaaggcaactgatggcatcgtcgaggaggcc
acggaggaggaactcatgaacgcaatgtcgctcgctgatcgcactggcatgtttgcttgc
ccgcatactggggttgccctcgcagcactgttcaagctccgtgaccagcgcatcatcggg
ccaaatgaccgcacggtagtcgtcagcacagctcatggtctgaagttctcacagtccaag
atcgactaccatgacagcaagatcgaagacatggcctgcaagtatgcgaatcccccggtc
agcgtgaaggctgacttcggtgccgtcatggatgtcctcaagaagaggctcaagggtaag
ctctga

DBGET integrated database retrieval system