KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340253Help
Entry
4340253           CDS       T01015                                 

Definition
(RefSeq) proteasome subunit alpha type-4-2
  KO
K02728  20S proteasome subunit alpha 3 [EC:3.4.25.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Module
osa_M00340  Proteasome, 20S core particle
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4340253
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:osa01002]
    4340253
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4340253
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     4340253
Peptidases [BR:osa01002]
 Threonine Peptidases
  Family T1: proteasome family
   4340253
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    4340253
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome Proteasome_A_N DUF3842
Motif
Other DBs
NCBI-GeneID: 4340253
NCBI-ProteinID: XP_015644466
UniProt: Q5VRG3
Position
6
AA seq 250 aa AA seqDB search
MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGSALGVLAADGVVLVGEKKVTSKLLQTSR
SAEKMYKIDSHLACAVAGIMSDANILLNTARLHAQRYALSYQEPIPVEQLVQSLCDTKQG
YTQFGGLRPFGVSFLFAGWDKHHGFQLYMSDPSGNYSGWKAAAVGANSQAAQSMLKQDYR
DGLTREEAVALALKVLSKTMDSTSLTAEKLELAEVFLQPGTGEVQYQVCSPEAMGKLLAK
AGLSQPAPEA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccggtacgacagccgcacgacgatcttctcgccggaggggcgtctctaccag
gtggagtacgcgatggaggcgatcgggaacgccgggtcggccctcggcgtcctggcggcc
gacggcgtggtcctcgtcggcgagaagaaggtcacctccaagctcctccagacctcgcgc
tccgccgagaagatgtacaagatcgactcccacctcgcctgcgccgtcgccgggatcatg
tccgacgccaacatcctcctcaacacggcgcgcctccacgcccagcgctacgccctctcc
taccaggagcccatccccgtcgagcagctcgtccaatccctctgcgacaccaagcagggg
tacacccagttcggcggcctccgccccttcggcgtctccttcctcttcgccggctgggac
aagcaccatggcttccagctctacatgagcgatccctccggcaactacagcggctggaag
gccgcggccgtcggggccaacagccaggcggcgcagtccatgctcaagcaggactaccgc
gacggcctgacccgggaggaggccgtagccctcgccctcaaggtcctgagcaagaccatg
gattcgaccagcttgaccgccgagaagctggagctcgccgaggtgttcctgcagcccggc
accggggaagtgcagtaccaggtgtgctcccctgaggcgatggggaagctgctcgccaag
gccggcctctcgcagccggcgcctgaggcttga

DBGET integrated database retrieval system