KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340385Help
Entry
4340385           CDS       T01015                                 

Definition
(RefSeq) B3 domain-containing protein Os06g0194400
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: B3 Anillin_N CAMSAP_CC1
Motif
Other DBs
NCBI-GeneID: 4340385
NCBI-ProteinID: XP_015642147
UniProt: Q69V36
Position
6
AA seq 237 aa AA seqDB search
MIEAESQMAEAASYEEQRRRQVEANKRKLEELRLHHLSAAVRESASKPSPVKQRKRKARA
LPGAGEDAPLRRSGRVANLPEKPKYRDEFQDFEKRIRRSYGGKRRDLSNRVYATDEQRDY
AINAAQELEEELGSDYPIFVKPMLQSHVTGGFWLSLPTHFSRKYLPKRDETIRLVDEEDD
EFDTLYLANKRGLSGGWRGFSIAHKLVDGDCLVFQLIQRTKFKVYIIRASSYYETDD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagcggaaagccaaatggcggaggcggcatcgtacgaggagcagcggaggcgg
caggtggaggcgaacaagcggaagctggaggagctccgcctccaccacctctccgccgcc
gtccgcgaatccgcctccaagccgtcgccggtgaagcagcggaagaggaaggcgcgtgcg
ctgccgggcgccggcgaggatgccccgctccggcggtccggccgcgtcgccaacctcccc
gagaagcccaagtaccgcgacgagttccaagatttcgagaagaggataaggaggtcttat
ggcggcaagaggagggatttgtccaatcgagtttacgcgaccgacgagcaaagggactac
gccatcaacgctgctcaagagctggaagaggagctcggctccgactacccaatcttcgtc
aagcccatgcttcagtcccatgtcactggagggttctggctgagcctgccgacgcatttc
agccggaagtatctgccgaagcgcgacgagactatccgtttggtggatgaggaggatgat
gagtttgacaccctctatcttgccaacaagagggggctcagtggagggtggagggggttt
tccattgctcataagctagttgatggagattgtttggtgttccaacttatccagcgcacg
aagttcaaggtctacataatcagagcaagttcctactatgaaactgacgactga

DBGET integrated database retrieval system