KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340972Help
Entry
4340972           CDS       T01015                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal isoform X1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00410  beta-Alanine metabolism
osa00592  alpha-Linolenic acid metabolism
osa00640  Propanoate metabolism
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4340972
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4340972
   00592 alpha-Linolenic acid metabolism
    4340972
   01040 Biosynthesis of unsaturated fatty acids
    4340972
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4340972
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4340972
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     4340972
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 4340972
NCBI-ProteinID: XP_015644169
Position
6
AA seq 420 aa AA seqDB search
MVIRFEGLVMGSSELRSPTLNLSIACPQLTPAASTFPAAASNYCQLDELLTEEEKDLQIK
VRQFMENEVAPIISKFWEKAEFPFHLIPKMSTLGIAGGTIKGYGCPGLSGPACAMCFLEI
ARVDASIASFCLVQSCLAMVSIAQLGSEAQKEKYLRPLSKMQKVCVYALSEPNHGSDASS
LNTTARKVPGGWILNGQKRWPANSSFADIFVVLACNTSTNQINGFIVNGGAPGLKISKID
NKMSLRVVQNCDILLEDVFVPDDDRLPGANSFQDLVKALSFSRVIVAWISIGIAAGVYDA
CLRYLGERKQFGAPLAAFQLNQEKLMWLLGWRLYELHDSGRMTTGQASLGKAWITKKARE
TVALGRELLGGNGIVTDFHVGKAFCDMESLYTYEGSYEVNALIVARDITGIASIRPASRL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggtgataagatttgaaggtcttgtaatggggtcttcagagctcaggtcaccgactttg
aacttgtccatagcttgcccccagcttacaccagctgcgtcgacctttccagcagcagca
tccaactattgccagcttgatgaactgctgacagaagaggaaaaggatctacaaatcaaa
gtccggcagtttatggagaatgaagttgcaccaataatatccaagttttgggagaaggcc
gaattcccgtttcatcttattccaaagatgagcactctcggaattgctggaggaactata
aagggctatggatgccctggactttctggcccagcttgcgccatgtgttttctagagatc
gctcgtgtggatgcaagcatagcctcattctgccttgttcagtcatgcctcgcaatggtt
agcattgcacaactcgggtcagaagcccagaaggagaagtatttgcgaccattgagcaaa
atgcagaaagtttgcgtatatgccttgtcagagccgaaccatggtagtgacgcgagctct
cttaacaccacagctagaaaggttcctggagggtggatactcaatggccagaagcgatgg
ccagcaaacagcagttttgcagatatcttcgtcgttcttgcctgcaataccagcaccaat
cagattaacggattcattgtgaatggaggcgcccccgggcttaagatcagcaagatcgac
aacaagatgtcgctgagggtcgtccagaactgcgacatcctgctggaggacgtcttcgtc
cctgatgatgaccgtcttcctggcgccaactctttccaagacctagtgaaggccctctct
ttctctcgcgtcatcgtcgcctggatcagtatcggcattgcggcaggggtgtacgacgca
tgccttcggtatctgggagagaggaagcagtttggggcgccattggcggcgttccagcta
aaccaggagaagctcatgtggctcctcggctggcgtctctacgagctgcatgactccggc
aggatgaccaccggccaggccagcttagggaaggcatggatcacaaagaaggcgcgggag
actgtggccttgggcagggagttgctcggtggcaacggcatcgtcaccgacttccacgtt
ggcaaggcgttctgcgacatggagtccttatacacgtacgagggcagctatgaagtcaat
gcactcatcgttgctagagacatcactggcatcgccagcatcaggccggctagccggctc
tag

DBGET integrated database retrieval system