KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341969Help
Entry
4341969           CDS       T01015                                 

Definition
(RefSeq) 60S acidic ribosomal protein P3
  KO
K02942  large subunit ribosomal protein LP1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Module
osa_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4341969
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4341969
Ribosome [BR:osa03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    4341969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_60s
Motif
Other DBs
NCBI-GeneID: 4341969
NCBI-ProteinID: XP_015641043
UniProt: P56724
Position
6
AA seq 119 aa AA seqDB search
MGVYTFVCRSSGDEWTAKQLKGELEASAATPYELQRRLVAAASAADSAAGVQSSFSMVSP
SSAVFQVIIGAVGGGAAIGGGAAAGAASGGAAAEAPKAEEKKEEEKEESEDDLGFSLFD
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgtacaccttcgtgtgccggagctccggcgacgagtggacggccaagcagctc
aagggcgagctggaggcctccgccgccaccccctacgagctgcagcgccgcctcgtcgcc
gccgcgtccgccgccgactcggccgccggagtccagtcctccttctccatggtctcgccc
agctccgccgtcttccaggtgatcattggtgccgttggtggtggtgccgcgattggtgga
ggtgctgctgctggtgccgcctccggtggagctgctgccgaggcccccaaggccgaggag
aagaaggaagaagagaaggaggaaagcgaggacgacctcggattctccctcttcgattag

DBGET integrated database retrieval system