KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341997Help
Entry
4341997           CDS       T01015                                 

Definition
(RefSeq) delta-aminolevulinic acid dehydratase, chloroplastic
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin and chlorophyll metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    4341997
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     4341997
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4341997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 4341997
NCBI-ProteinID: XP_015643005
UniProt: Q5Z8V9
Position
6
AA seq 426 aa AA seqDB search
MASTVSFSPANVQMLQGRSCHGHAAFGGCSAVPRTGPRMRSVAVRVSSEQEAAPAVRAPS
GRTIEECEADAVAGRFPAPPPLVRPKAPEGTPQIRPLDLTKRPRRNRRSPALRAAFQETT
ISPANLVLPLFIHEGEDDAPIGAMPGCYRLGWRHGLLDEVYKSRDVGVNSFVLFPKVPDA
LKSQSGDEAYNDNGLVPRTIRLLKDKFPDIVVYTDVALDPYSSDGHDGIVREDGVIMNDE
TVYQLCKQAVSQARAGADVVSPSDMMDGRVGAIRAALDAEGFHDVSIMSYTAKYASSFYG
PFREALDSNPRFGDKKTYQMNPANYREALLETAADEAEGADILLVKPGLPYLDVIRLLRD
NSALPIAAYQVSGEYSMIKAGGALNMIDEEKVMMESLMCLRRAGADIILTYFARQAANVL
CGMRSN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaccgtctccttctccccggccaacgtgcagatgctccagggcaggagctgc
cacggccacgcggcgttcgggggctgctccgccgtgccaagaaccgggccaaggatgcgt
tccgtggccgtgagggtcagcagcgagcaggaggcggcgccggcggtcagggcgccgtcg
gggaggaccatcgaggagtgcgaggccgacgccgtggccgggagattcccggctcccccg
ccgttggtcagacccaaggctcccgaaggaacacctcagatcaggcctcttgacttgaca
aagcgccctcgtcgcaaccgcaggtcgcctgctcttagggccgcattccaggagaccacc
atctcacctgccaatttggtgctcccgctgttcatccatgaaggggaagatgatgctcct
attggagctatgcctgggtgctataggcttggttggaggcatgggcttcttgatgaggtc
tacaagtctcgtgatgttggtgttaacagttttgtgctgtttccaaaagttcctgatgca
ttgaagtctcaatctggagatgaggcatacaatgataatggtttggttccacggactatt
cgcctgctcaaggataaattccctgacattgttgtctacacggatgttgctctggaccct
tattcatctgatggtcatgatggcattgtcagggaagatggagtaattatgaatgatgaa
acagtttatcaactgtgcaagcaggctgtttcacaggcacgtgctggtgctgatgtagtt
agccctagtgacatgatggatggccgtgttggagcaatacgtgctgctttggatgctgag
ggtttccatgatgtctccattatgtcctatactgcaaagtacgccagttcgttttatggc
ccattccgagaagctttggattcaaatccaagatttggggacaagaagacttaccagatg
aacccagctaactacagagaagcgcttctagaaactgctgcagatgaggcagaaggagct
gatattcttctggtaaaacctggattgccatacttggatgtcatccgtcttcttagggac
aattcagcattgccaatcgctgcatatcaggtctctggagagtactccatgatcaaagct
ggaggagcactgaacatgatcgacgaagagaaggtgatgatggagtcgctcatgtgcctg
aggcgagccggcgctgacatcatcctgacgtatttcgcgcgtcaggccgccaacgtgctg
tgcggcatgcgatccaactag

DBGET integrated database retrieval system