KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342193Help
Entry
4342193           CDS       T01015                                 

Definition
(RefSeq) kinesin-5
  KO
K10405  kinesin family member C1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:osa03036]
    4342193
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:osa04812]
    4342193
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    4342193
Cytoskeleton proteins [BR:osa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     4342193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd DUF768 Spc7
Motif
Other DBs
NCBI-GeneID: 4342193
NCBI-ProteinID: XP_015644739
UniProt: A3BFT0
Position
7
AA seq 764 aa AA seqDB search
MSTRATRPGMLHQKENAADAQAGKRQRTAAGSAARAPLSANAAPPAPDPAIEFAGRDDVD
ALLNEKMKGKNKMDYKGKSEQMMEYIKKLRACIKWLLEREDTNLAEIGKLNGLLEAAEKH
HSEIVAQLKSAIEESKAINEELQRQYASLEENLKRVEAEKLDALRSYGDEKEARIAVEAS
RNEHLEDLRRIKLEEKRLNDQIKMLQDTNKRLQEYNTSLQQYNSNLQADATKNGETIAKL
QKEKNTMVETMNGLKDHANSVKMQLDLAKSSQNEALKQKTDLLKEVDNLRGELQQVRDDR
DHKLAEIHSLLADVSTYKEMTGKSVAELDNAMTRSTALEETCSSQAERIKTLELQLASAN
EKLKRSDLTTMETMTEYEKQKRMLEDLQLRLEEAEQQILDGENLRKRLHNTILELKGNIR
VFCRVRPLLPNESGAVAYPKSGENLGRGIELTHNAQMYSFTFDKVFEQSASQEDVFIEIS
QLIQSALDGYKVCIFAYGQTGSGKTYTMMGNPELHDQKGLIPRSLEQIFQTSQALISQGW
KYKMQASMLEIYNEAIRDLLATNRTTVQDGGASKYSIKHDANGNTHVSDLTIVDVSSINE
VSSLLKRAAQSRSVGRTQMNEESSRSHCVFTLRIFGVNEGTDQQVQGVLNLIDLAGSERL
NKSGATGDRLKETQAINKSLSCLSDVIFSIAKKEEHVPFRNSKLTYLLQPCLGGDSKTLM
FVNLSPEVSSTGESICSLRFAARVNSCEIGIPRRQTQVRSLAQG
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgcgcgccactcgccccgggatgctccaccagaaggagaacgccgccgacgcg
caggccggcaagcgccagcgcacggccgccgggtccgccgcccgcgccccgctctccgcc
aacgccgctccgcccgcccctgaccccgccatcgagttcgccgggagggacgatgtcgac
gccctcctcaacgagaagatgaagggcaagaacaagatggactacaaggggaagagcgag
caaatgatggaatacataaaaaagctacgggcttgcatcaagtggctgctagagagggag
gatacaaacctggctgagattgggaagctcaatggtctacttgaggcggcagagaaacat
cactctgagattgtggctcagctgaaaagtgcaatagaagaatcaaaggcaataaatgag
gagcttcagagacagtatgcttctttagaggagaatctaaagagagtggaggctgagaaa
ctggatgcccttaggtcttatggagatgaaaaggaagcaaggattgctgttgaggcttcc
cgaaatgagcatttggaagatcttagaaggattaagttggaggaaaaacgccttaatgat
cagatcaagatgcttcaggacacaaataagaggcttcaagaatacaacactagtttgcag
cagtataacagcaacctccaggcagatgcaacgaagaatggtgaaacaatagcaaagctg
cagaaagagaagaacactatggtagaaacaatgaatggtttgaaggaccatgctaactct
gtaaagatgcagctagatttggcaaagtcttcccaaaatgaagctctaaaacaaaagacc
gacttgctaaaggaagttgataatctcaggggtgaactccagcaagtaagggatgaccgt
gatcataaattagctgaaatacattccttgttggccgatgtaagtacatacaaggaaatg
actggaaagtcggtagcagaattggataatgccatgacaagaagtactgcccttgaggaa
acatgttcgtcccaagcagagagaattaaaacattggagctgcagcttgcatcagctaac
gaaaagttaaagagatctgatttgactactatggagacgatgactgagtatgagaagcaa
aaaagaatgttggaggatctgcaattacgactcgaagaagctgagcaacaaattttggac
ggagagaatttgcggaaaagactccataatacaatactcgagcttaagggaaacattcga
gtattctgtagggtgcgacctttattgccaaatgaatcaggagctgttgcttatccaaag
agtggagaaaacttaggtcgtggcattgagttgacacataatgctcaaatgtattctttc
acatttgacaaagtatttgagcagtcggcatcacaagaagatgtgttcattgagatttcc
caactcatccaaagcgcccttgatggctacaaggtgtgcatatttgcatatggccaaact
ggctcgggtaaaacatacacaatgatgggaaatccagaattgcatgaccagaaaggatta
attccgagatcacttgaacaaattttccaaacaagccaggctcttatttcacagggatgg
aaatataagatgcaggcatctatgctggaaatctacaatgaagccatacgtgatctgcta
gccactaatcgcacaactgttcaagatggtggcgcttcaaagtacagtatcaagcatgat
gccaatggtaatacccatgtatcagatctcacaattgtcgatgtatcgagtatcaatgaa
gtttcttctctcctcaagcgggctgctcagagcagatctgttggaagaacacagatgaac
gaagaatcatctagaagtcattgtgtgttcacgcttcgaatttttggtgtcaatgaggga
acagaccagcaggtgcaaggagtgctcaatctaatcgatcttgccggcagtgagcggctt
aacaagagcggtgccaccggagataggctaaaggagacacaggctattaataagagcctc
tcatgcttgagcgatgtaatcttctccattgcaaagaaagaggagcacgttccgttcagg
aactcaaaattaacgtacttgctacagccatgccttggaggagactcgaagacacttatg
tttgtgaatctgtctccagaggtgtcgtctacaggggagtcaatttgctcgctacggttc
gcagcacgggtgaactcgtgcgagattggcatccctcgtcgtcaaacccaagtgcgtagc
ttggcgcaaggatga

DBGET integrated database retrieval system