KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342210Help
Entry
4342210           CDS       T01015                                 

Definition
(RefSeq) glutamate--glyoxylate aminotransferase 2
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4342210
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4342210
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4342210
   00260 Glycine, serine and threonine metabolism
    4342210
   00220 Arginine biosynthesis
    4342210
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     4342210
    2.6.1.4  glycine transaminase
     4342210
    2.6.1.44  alanine---glyoxylate transaminase
     4342210
Amino acid related enzymes [BR:osa01007]
 Aminotransferase (transaminase)
  Class I
   4342210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 4342210
NCBI-ProteinID: XP_015646972
UniProt: Q69UU3
Position
7
AA seq 485 aa AA seqDB search
MFGGGGGGGRKPLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQ
KPLTFPRQVVALCQAPFLLDDPNVGLIFPADAIARAKHYLAMAPGGLGAYSDSRGIPGIR
KEVAEFIERRDGYPSDPELIYLTDGASKGVMQMLNTIIRNERDGILVPVPQYPLYSAAIS
LFGGSLVPYYLEEEANWGLDFVNLRQTVASARSKGITVRAMVIINPGNPTGQCLSEGNIK
ELLKFCFHENLVLLADEVYQQNIYQDERPFISARKVLFDMGPPMSREVQLVSFHTVSKGY
WGECGQRGGYFEMTNLPPKTVDEIYKVASIALSPNVPGQIFMGLMVNPPKPGDISYLKFS
AESKSILESLRRRARLMTDGFNSCRNVVCNFTEGAMYSFPQIRLPPKAIDAAKRAGKAAD
VFYCLKLLEATGISTVPGSGFGQKEGVFHLRTTILPAEEDMPAIMTSFKKFNDTFMDQYD
GYSRM
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgttcggcggcggcggcggcggcgggaggaagccgctggactacgaggagctgaacgag
aacgtgaagaaggtgcagtacgcggtgcggggggagctgtacctgcgcgcctccgagctc
cagaaggagggcaagaagatcatcttcaccaacgtcggcaacccacacgcgctcggccag
aagccgctcaccttcccccgccaggttgtggcgctgtgccaggcccccttcctgctcgat
gatcccaacgtcggccttatcttccccgccgacgccatcgcgcgggccaagcactacctc
gccatggcacccggtggactaggtgcttacagtgattcccgaggtatccctggtattagg
aaggaagtcgccgagttcatcgagaggcgtgatggttatccaagtgatccagaacttatt
tacctcacagatggtgccagcaaaggtgtgatgcaaatgctgaataccattatcagaaat
gagagagatgggattctggttcctgttccacaatacccgctttattctgctgccatttcc
ctctttggtggttctctcgtgccatactacttagaagaagaggctaactggggacttgac
ttcgtcaatctccgacagactgtggcgtcagcgcggtcaaagggaatcactgttcgagca
atggtgattatcaacccaggaaaccctactggccaatgccttagtgaaggaaacataaag
gaacttctcaaattctgcttccatgagaacttagttctgcttgcagatgaagtctatcaa
cagaacatttatcaagatgagcgcccatttataagtgctagaaaggttctgtttgacatg
ggtcctcctatgagcagggaagttcagctggtttctttccatactgtgtcaaaaggatat
tggggggagtgtggacaacgtggagggtattttgaaatgacaaatcttcctcccaagaca
gtagacgagatctacaaggttgcatcaatcgcactcagtccaaatgttcctgggcagatc
tttatgggtttaatggttaaccctcctaagcctggagatatctcttatctgaagttttct
gctgaaagcaagtctatcctcgagtctttgaggaggagagcacgcctgatgacagatggt
ttcaatagttgccgaaatgttgtctgcaatttcacagaaggagctatgtactctttcccc
caaatacgcttaccaccaaaagctatagatgcagccaaaagggctggcaaagcggccgat
gttttctactgcctcaagcttcttgaagcaactggaatatccactgttccagggtcaggt
ttcggacaaaaagaaggggtgttccacctgaggacgaccatcctgccagctgaggaggac
atgcctgccatcatgaccagcttcaagaagttcaacgacactttcatggatcagtacgat
ggctactccaggatgtga

DBGET integrated database retrieval system