KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343372Help
Entry
4343372           CDS       T01015                                 

Definition
(RefSeq) tRNA wybutosine-synthesizing protein 2/3/4
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4343372
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     4343372
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    4343372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 Met_10 Kelch_1 Kelch_6 Kelch_4 Kelch_5 Kelch_2 Kelch_3 DNA_methylase MTS PBP_N
Motif
Other DBs
NCBI-GeneID: 4343372
NCBI-ProteinID: XP_015646654
Position
7
AA seq 1064 aa AA seqDB search
MEFDRRKAAALAALASPAPDKSPKGGVDAPIAPLLDALNSHPDLFTTSSCSGRVSVLAQP
PPPQQADPGGAKTKKKARGGGWVYISHDPADPEALVEVLFGVKEGGGGGDDELVFRFEPM
IVAVECRDAAAAAALVAAAVGAGFRESGITSLQKRVMVALRCSIRMEVPLGQTKELVVSP
DYIRYLVRIANSKMEANKKRMGGFLDLLQAKGLLGSSKGCATADNESLVAKKSSDTYNCD
ADNNCDNGFVEISLEASYLESQDPVLQNGAKHGFGNAKRLTQEEALPTLSGNTTHCLSTA
ALEITGEPIEKLFLWGQSACALTVGREHHILTFGGFGGPGRHARRNYSLLVNPGSGLLTE
LKVTGSPSPRMGHTITVVGNDIYVVGGRSGPSEILNDIWVLERSNNRWSKVDCSGDFFRP
RHRHAAAAVDRKVYVFGGLSDDGLCSCMNIMDTASIQWNVISPDDKWPCARHSHSLVSYG
SKLFLFGGHDGQRALNDFYSFDTTTLKWNKENTNGKAPSPRFSHCMFIYKDYLGILGGCP
IRESSQEIALLNLKHKIWFYVSIPSLSQCLCVRSSSVIIDDDLVIVGGGASCYAFGTRFS
QPIKIDLHLLESIFKLAYNKEKEMSVQHGSVSNVDLLEGHEENCNPSDNVKVVIDTATLG
SSPLVLQLEKKYAKLAKDILKKFGWLDLTRKVRVSQDNIHVLFPVSKTFHALITDKHLKV
QPDDSCVFEELLPFSENKLFGASISLQKALEILLLCRGSILKDEVAISRKASKTPQTIMR
ELVSVLLDKKGLPSQLLEQLPTRWETLGDIIVLPKTCFKDPLWESVRDDLWPLVAKSLGA
QRLARQGKITPNGTRDSTLELLVGNDGWLTHHENGICYSLDATKCMFSSGNRSEKLRMGK
LDCRDEVVVDLFAGIGYFVLPFLVKANAKLVYACEWNPHALEALQRNVMDNHVADRCIIL
EGDNRLTAPKGIADRVCLGLLPSSECSWDTAVRALRAEGGMLHIHGNVNDSDESLWLDNV
VKSITNIAKTHGLSWNVTVEHVERVKWYGPHIRHLVVDVKCRAT
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgatcgccggaaggcggcggcgctggccgcgctcgcgtcgccggcgccggac
aagtcgccgaagggcggcgtcgacgcgcccatcgcgccgctcctcgacgccctgaactcc
cacccggacctcttcaccacctcctcctgctccggccgcgtctccgtcctcgcgcagccg
ccgccgccgcagcaggccgaccccggcggggccaagaccaagaagaaggcgcggggcggc
gggtgggtgtacatctcccacgaccccgcggacccggaggccctggtggaggtgctgttc
ggtgtgaaggaagggggagggggaggcgatgatgagctcgtgttcaggttcgagccgatg
attgtggccgtggagtgcagggacgcggctgcggcggcggcgctcgtggctgccgcggtt
ggcgcggggttccgtgagtcaggcatcacaagcttgcagaaacgtgtaatggtagcattg
agatgctcaattcggatggaggtgccactaggtcagaccaaagagctcgttgtctctcct
gattatattaggtaccttgttagaattgccaacagtaaaatggaggctaacaagaagcga
atgggtggattcctggatcttttgcaggctaagggtctcctaggttcatccaaaggatgt
gcaactgcagataatgaatccttagttgcaaaaaagagtagtgatacctataattgtgat
gctgataataattgtgataatggatttgtggagatttcactagaagcatcatatttggag
agtcaagaccctgtacttcaaaatggtgccaagcatggttttggtaatgctaaacgatta
acacaagaggaagcattgccaacattgtcaggaaatacaactcactgcctttctactgct
gcattggagattactggtgaacctattgagaagctcttcttatggggacaatctgcttgt
gcactcactgttggaagagagcaccatatcctaacttttggtggttttggagggccaggg
aggcacgcaagaagaaattactctcttctggttaatcctgggtcaggattgctgacagaa
ttaaaggttactgggtcgccttcaccacggatgggccatacaattactgtagtaggcaat
gatatttatgttgttggaggcagaagtggtccttcagaaattcttaatgatatctgggtt
ttggaaagatctaacaatagatggtcaaaagtggactgcagtggggattttttccgtcca
aggcaccgacatgctgctgctgcagtagatcgcaaagtatatgtctttggtggactaagt
gatgatggcttatgttcttgcatgaacataatggacacagcaagtatccaatggaatgtg
atttctcctgatgacaaatggccatgtgctcgccactcgcattctctagtgtcctatggt
tcaaaattgtttctgtttggaggtcatgatggtcagagggcactgaatgatttctatagt
tttgatacaacaacacttaagtggaacaaagaaaacactaatgggaaagctccatcccct
agattttcacattgcatgttcatctacaaagactatctcggcatacttggaggttgtcct
attagagaaagcagtcaagaaattgcattgctaaatttaaagcataaaatctggttttat
gtatccattccatcattgagccaatgcctttgtgtccgtagctcatcagtcatcattgat
gatgatcttgtcattgttggtggtggtgcgtcttgctatgcatttggaactagattcagt
cagccaataaaaattgatctgcatttgctggagtcaatatttaagcttgcatacaacaag
gaaaaagaaatgtctgtacaacacggttcagtgtcgaatgtagacttattagaaggacat
gaggaaaattgcaatcccagtgataatgtgaaggtggtgattgatactgctactctaggt
tcatctcctttggtccttcagctagaaaagaagtatgccaaattagcaaaagacattcta
aaaaagtttggatggttggatcttactagaaaagttcgagtaagccaggataacatccat
gttctctttcctgttagtaaaacttttcatgccctaatcactgataagcatctcaaggta
caacctgatgattcatgtgtttttgaagaactattgccgttttctgaaaataagcttttt
ggggccagcatttctcttcagaaagcactagaaattttgttgttatgccgtggttccatt
ctgaaagatgaagtagcgatcagccgcaaagcttctaaaactcctcaaaccatcatgaga
gagcttgtgtctgttctactggataaaaaaggattgcctagccagttattggagcagctg
ccaactaggtgggaaacccttggtgatattattgtgcttccaaaaacttgctttaaggat
ccactgtgggaatcagttagagatgatctttggccactagttgcaaagtcacttggggca
caacgccttgcacgccagggtaaaatcacaccaaatggcacaagagatagcactttagaa
cttctagtgggcaatgacgggtggttgacacatcatgaaaatggcatttgttactcactt
gatgcaacaaaatgcatgttttcttctggtaaccggtctgagaagcttcgcatggggaag
cttgattgtagggatgaagtggtggtggacttgtttgcagggattggatactttgttcta
ccatttcttgtgaaggctaatgccaagttagtctacgcatgtgaatggaatccacatgcc
ctggaggctcttcaacgtaatgtcatggacaaccatgtggcagatcgatgtattatactt
gaaggagataaccgtttgacagcacctaaagggattgctgaccgtgtttgtcttgggttg
ttgccctcgagtgaatgtagctgggacactgctgtgagggctttaagggctgaaggtggc
atgctgcacatacatgggaatgtcaacgactcggatgagtcgctctggttggacaatgtt
gttaagtccatcactaacattgccaaaacacatggactgtcttggaacgtcacggtggag
catgtcgaacgcgtcaaatggtacggtccgcatatacgacatctcgtggttgatgtcaaa
tgccgggcaacctaa

DBGET integrated database retrieval system