KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343620Help
Entry
4343620           CDS       T01015                                 

Definition
(RefSeq) 40S ribosomal protein S11
  KO
K02949  small subunit ribosomal protein S11e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Module
osa_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4343620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4343620
Ribosome [BR:osa03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    4343620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S17_N Ribosomal_S17
Motif
Other DBs
NCBI-GeneID: 4343620
NCBI-ProteinID: XP_015646984
UniProt: Q7XIK5
Position
7
AA seq 161 aa AA seqDB search
MAEQTEKAFLKQPKVFLSSKKSGKGKKPGKGGNRFWKSIGLGFKTPREAIEGTYIDKKCP
FTGTVSIRGRIIAGTCHSAKMNRTIIVRRNYLHFVKKYQRYEKRHSNIPAHVSPCFRVKE
GDHVIIGQCRPLSKTVRFNVLKVIPAGSTGGSGGKKAFTAA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcagactgagaaggcattcctgaagcagccaaaggttttcctcagctcaaag
aagtctggcaagggtaagaagccaggtaagggtggcaaccgtttctggaagagcattggc
cttggcttcaagactcccagggaagcaattgaagggacatacattgataagaagtgccca
ttcactggaactgtttctatcagaggcagaatcattgccggaacatgccatagtgctaag
atgaacaggactatcattgttcgcaggaactacctccactttgtgaagaaatatcagagg
tatgagaagaggcattccaacattccggctcacgtctccccatgcttccgtgtcaaggaa
ggtgaccatgtcatcattggccagtgcaggccgctgtcgaaaactgtgaggttcaacgtc
ctgaaggtcatcccagctggatccaccggcggcagcggcggcaagaaggccttcaccgca
gcatga

DBGET integrated database retrieval system