KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343710Help
Entry
4343710           CDS       T01015                                 

Definition
(RefSeq) probable succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4343710
   00640 Propanoate metabolism
    4343710
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     4343710
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     4343710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 4343710
NCBI-ProteinID: XP_015647737
UniProt: Q6ZL94
Position
7
AA seq 331 aa AA seqDB search
MAASARRASQLLGSAASRLLHARGFAAAAAAAPSPAVFVDKSTRVICQGITGKNGTFHTE
QAIEYGTTMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAM
EAELDLVVCITEGIPQHDMVKVKAALNKQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKP
GRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIV
LIGEIGGTAEEDAAAFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIK
ALREAGVTVVESPAKIGSTMFEIFKQRGMLE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctccgcccgccgcgcgtcccagctgctgggatccgcggcctcccgcctcctc
cacgcgcggggcttcgcggcggcggccgcggccgcgccgtcgccggcggtgttcgtggac
aagagcacccgcgtgatctgccagggcatcaccgggaagaacggcaccttccacaccgag
caggccatcgagtacggcaccaccatggtaggtggggttacccctaagaaaggtggaacc
gagcacctaggccttccggtgttcaactctgtggcagaagctaaggctgagacaaaggcg
aatgcatctgttatatatgttccaccaccatttgctgctgctgcaataatggaagcgatg
gaggccgaacttgaccttgttgtctgcattaccgaagggatacctcagcatgacatggtg
aaagtgaaggctgctctgaacaagcaatcaaaaactcggttgattggaccaaattgccct
ggtatcattaagccgggtgaatgtaaaattggaatcatgccaggttacatccacaagcca
ggtcgtgttgggatagtatctcgctctggtaccttgacatatgaagcggtgtttcaaaca
acagccgtaggcttggggcagtcaacgtgtgttggcattggtggtgatcccttcaatggc
acgaattttgttgattgccttgaaaagtttgttgatgatcctcagacagaaggtattgtt
ctcatcggagaaattggaggtactgctgaggaggatgctgcagccttcattcaggagagc
aaaacacaaaagcctgttgttgcattcatagctggactcactgctccacctgggcgtcgc
atgggtcatgctggagcaattgtgtcagggggcaagggtacggcacaagacaaaatcaag
gctctcagagaggctggggttactgttgttgagtcaccagcgaagattggttcaactatg
ttcgaaattttcaagcaacgcggaatgttagaatag

DBGET integrated database retrieval system