KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344382Help
Entry
4344382           CDS       T01015                                 

Definition
(RefSeq) pyruvate decarboxylase 3
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4344382
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     4344382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 4344382
NCBI-ProteinID: XP_015646176
UniProt: Q0D3D2
Position
7
AA seq 587 aa AA seqDB search
MESNGGGGGSPKEAAVVVPSSGDATLGGHLARRLVQVGVSDVFAVPGDFNLTLLDHLIAE
PGLRVVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIGGAYSENLPLICIVG
GPNSNDYGTNRILHHTIGLPDFSQELRCFQPLTCYQAVVNNLDDAHDQIDRAISTAIRES
KPVYISVSCNLPAVPHPTFSRDPVPYFLSPRLSNQASLHAALDATLAFLDKAVKPVLVAG
PKLRVAKAGGAFVDLADASGHAVAAMPSAKGLVPETLPRFIGTYWGAVSTAFCAEIVESA
DAYLFAGPIFNDYSSVGYSCLLKKEKAVVVQPDRVTVGNGPAFGCVMMRDFLSELAKRVR
KNTTAFDNYKRIFVPEGQLPECEAGEALRVNVLFKHIQRMIGGTEIGAVMAETGDSWFNC
QKLRLPEGCGYEFQMQYGSIGWSVGALLGYAQAVQKRVVACIGDGSFQVTAQDVSTMLRC
GQRSIIFLINNGGYTIEVEIHDGPYNVIKNWDYVGLVNAIHNGEGRCWATRVRCEEELEA
AIATATGDKADSLCFIEVVAHKDDTSKELLEWGSRVSAANSRPPNPQ
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaacggcggaggaggaggatctcccaaggaggcagcggtggtggtgccgtcc
tccggcgacgccaccctgggcgggcacctggctcggcgcctcgtgcaggtgggcgtgagc
gacgtgttcgccgtgccgggggacttcaacctgacgcttctggaccacctgatcgccgag
cccgggctccgcgtggtgggctgctgcaacgagctgaacgccggatacgcggccgacggg
tacgcgcgggcccgtggcgtgggcgcctgcgccgtgaccttcaccgtgggcgggctgagc
gtgctgaacgccatcggcggggcgtacagcgagaacctgccgctgatctgcatcgtgggg
ggccccaactccaacgactacggcaccaaccgcatcctccaccacaccatcggcctcccg
gacttctcccaggagctccgctgcttccaacccctcacctgctaccaggccgtcgtcaac
aacctcgacgacgcccacgaccagatcgaccgcgccatctccaccgccatcagggagagc
aagcccgtctacatcagcgtcagctgcaacctccccgccgtcccccaccccaccttctcc
cgcgacccggtgccctacttcctctccccgaggctctccaaccaggccagcctccacgcc
gcgctcgacgccaccctcgccttcctcgacaaggccgtcaagcccgtcctcgtcgcgggg
cccaagctccgcgtcgccaaggccggaggggccttcgtggacctcgccgacgccagcggc
cacgcggtggccgccatgccgtccgccaaggggctggtgccggagacgctgccgcgcttc
atcgggacctactggggcgcggtcagcacggccttctgcgcggagatcgtggagtccgcg
gacgcctacctgttcgcggggcccatcttcaacgactacagctccgtggggtactcgtgc
ctgctgaagaaggagaaggcggtggtggtgcagcccgaccgcgtgaccgtcggcaatggc
cccgcgttcgggtgcgtgatgatgagggacttcctgtcggagctggccaagcgcgtccgg
aagaacacgacggcgttcgacaactacaagaggatcttcgtgccggagggacagctgccg
gagtgcgaggccggggaggcgctgcgggtgaacgtgctgttcaagcacatacagaggatg
atcggtggcacggagatcggggcggtgatggcggagacgggggactcgtggttcaactgc
cagaagctgcggctgcccgagggttgcgggtacgagttccagatgcagtacggctccatc
gggtggtcggtgggggcgctgctgggctacgcgcaggctgtccaaaaacgggtggtggct
tgcatcggcgacggcagcttccaggtgacggcgcaggacgtgtcgacgatgctgcgttgc
gggcagcggagcatcatcttcctcatcaacaacggcgggtacaccatcgaggtggagatc
cacgacgggccgtacaacgtgatcaagaactgggactacgtgggcctcgtcaacgccatc
cacaacggcgaggggcggtgctgggccacccgggtgcggtgcgaggaggagctggaggcg
gccatcgcgacggccacgggggacaaggcggacagcctctgcttcatcgaggtggtggcg
cacaaggacgacaccagcaaggagctcctcgaatggggctccagagtctccgccgccaac
tccaggccgcccaacccgcagtag

DBGET integrated database retrieval system