KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344636Help
Entry
4344636           CDS       T01015                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00380  Tryptophan metabolism
osa00950  Isoquinoline alkaloid biosynthesis
osa00965  Betalain biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4344636
   00360 Phenylalanine metabolism
    4344636
   00380 Tryptophan metabolism
    4344636
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    4344636
   00950 Isoquinoline alkaloid biosynthesis
    4344636
   00965 Betalain biosynthesis
    4344636
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4344636
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     4344636
    4.1.1.105  L-tryptophan decarboxylase
     4344636
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4344636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC SepSecS
Motif
Other DBs
NCBI-GeneID: 4344636
NCBI-ProteinID: XP_015648701
UniProt: Q6ZJK7
Position
8
AA seq 514 aa AA seqDB search
MGSLDTNPTAFSAFPAGEGETFQPLNADDVRSYLHKAVDFISDYYKSVESMPVLPNVKPG
YLQDELRASPPTYSAPFDVTMKELRSSVVPGMTHWASPNFFAFFPSTNSAAAIAGDLIAS
AMNTVGFTWQASPAATEMEVLALDWLAQMLNLPTSFMNRTGEGRGTGGGVILGTTSEAML
VTLVAARDAALRRSGSDGVAGLHRLAVYAADQTHSTFFKACRLAGFDPANIRSIPTGAET
DYGLDPARLLEAMQADADAGLVPTYVCATVGTTSSNAVDPVGAVADVAARFAAWVHVDAA
YAGSACICPEFRHHLDGVERVDSISMSPHKWLMTCLDCTCLYVRDTHRLTGSLETNPEYL
KNHASDSGEVTDLKDMQVGVGRRFRGLKLWMVMRTYGVAKLQEHIRSDVAMAKVFEDLVR
GDDRFEVVVPRNFALVCFRIRAGAGAAAATEEDADEANRELMERLNKTGKAYVAHTVVGG
RFVLRFAVGSSLQEEHHVRSAWELIKKTTTEMMN
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcttggacaccaaccccacggccttctccgccttccccgccggcgagggtgaa
accttccagccgctcaacgccgatgatgtccggtcctacctccacaaggcggtggacttc
atctcggactactacaagtccgtggagtccatgccggtgctgcccaatgtcaagccgggg
tacctgcaggacgagctcagggcctcgccgccgacgtactcggcgccgttcgacgtcacc
atgaaggagctccggagctccgtcgtccccgggatgacgcactgggcgagccccaacttc
ttcgcgtttttcccctccacgaatagtgcggccgccattgccggcgacctcatcgcgtcg
gcgatgaacacggtcgggttcacgtggcaggcgtcgccggcggccaccgagatggaggtg
ctcgcgctggactggctcgcgcagatgctcaacctgccgacgagcttcatgaaccgcacc
ggcgaggggcgtggcaccggcggtggggttattctggggacgaccagcgaggcgatgctc
gtcacgctcgttgccgcgcgcgacgccgcgctgcggcggagcggcagcgacggcgtggcg
ggactccaccggctcgccgtgtacgccgccgaccagacgcactccacgttcttcaaggcg
tgccgcctcgccgggtttgatccggcgaacatccggtcgatccccaccggggccgagacc
gactacggcctcgacccggcgaggctgctggaggcgatgcaggccgacgccgacgccggg
ctggtgcccacctacgtgtgcgccacggtgggcaccacgtcgtccaacgccgtcgacccg
gtgggcgccgtggccgacgtcgcggcgaggttcgccgcgtgggtgcacgtcgacgcggcg
tacgccggcagcgcgtgcatctgcccggagttcaggcaccacctcgacggcgtggagcgc
gtggactccatcagcatgagcccccacaaatggctgatgacctgcctcgactgcacctgc
ctctacgtgcgcgacacccaccgcctcaccggctccctcgagaccaacccggagtacctc
aagaaccacgccagcgactccggcgaggtcaccgacctcaaggacatgcaggtcggcgtc
ggccgccgcttccgggggctcaagctctggatggtcatgcgcacctacggcgtcgccaag
ctgcaggagcacatccggagcgacgtcgccatggccaaggtgttcgaggacctcgtccgc
ggcgacgacaggttcgaggtcgtcgtgccgaggaacttcgctctcgtctgcttcaggatc
agggccggcgccggcgccgccgccgcgacggaggaggacgccgacgaggcgaaccgcgag
ctgatggagcggctgaacaagaccggcaaggcgtacgtggcgcacacggtggtcggcggc
aggttcgtgctgcgcttcgcggtgggctcgtcgctgcaggaagagcatcacgtgcggagc
gcgtgggagctcatcaagaagacgaccaccgagatgatgaactaa

DBGET integrated database retrieval system