KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346215Help
Entry
4346215           CDS       T01015                                 

Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00072  Synthesis and degradation of ketone bodies
osa00280  Valine, leucine and isoleucine degradation
osa00650  Butanoate metabolism
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4346215
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    4346215
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4346215
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4346215
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     4346215
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III_C DNAP_B_exo_N
Motif
Other DBs
NCBI-GeneID: 4346215
NCBI-ProteinID: XP_015650115
UniProt: Q6ZBH5
Position
8
AA seq 467 aa AA seqDB search
MEQPNDVGILAMDIYFPPACVHQEALEAHDGASKGKYTIGLGQDCMAYCSEVEDVISMSL
TVVASLLKKYNIDPKQIGRLEVGSETVIDKSKSIKTWLMHIFEESGNTDIEGVDSSNACY
GGTAALLNCVNWVESKSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISFE
SKYRASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRQYCTKYEKIVGEQFSI
SDAEYCVFHSPYNKLVQKSFARLYFNDFMRNCSTVDNDAKEKLQPFANLTSEESYQSRDL
EKASQQVAKHLYDIKVQPSTLLPKQIGNMYTASLYAALASVIYNKHDSLDGQRILMFSYG
SGLTSTMFSLRLHDGQHPFSLMNIASVLDVTTKLESRHVTSPEKFIETLKLMEHRYGAKD
FETSKDTSLLPPGTFYLTKVDSMYRRFYDKKAAEGKIKGCNGIANGH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcccaacgacgtcgggatcctcgccatggacatctacttccctcccgcctgc
gtccaccaggaagcgctggaagcgcacgatggagccagcaagggtaagtacacaattggt
cttgggcaggactgcatggcctattgcagcgaggtggaagatgttatctctatgagcttg
acggttgttgcatcactgctgaaaaagtacaacattgatcctaagcaaattggccgcctg
gaggttggtagtgagacagtgatagacaaaagcaaatccatcaaaacatggctgatgcat
attttcgaggagagtggcaatactgacattgagggggttgactcaagtaacgcatgctat
ggtggaacagctgccctgttgaattgtgttaattgggtggaaagtaaatcctgggatgga
cgctacggtcttgttgtttgcacagatagcgcggtttatgcagaagggccagctcgtcca
acaggtggtgctgctgctattgctatgcttattggtccgaatgctcccatttcttttgaa
agtaaatatagggcttcacacatggcccatgtttacgatttctacaagcctgatcttgca
agtgaatacccggttgttgatggaaaactttctcagacatgctatctgatggctcttgat
tcgtgctataggcaatattgtaccaagtatgaaaagatagtgggagaacaattctcgatt
tctgatgcagaatactgtgtcttccattctccatataataagcttgtacaaaagagtttc
gcccgactttatttcaatgacttcatgcgtaattgcagcacggttgataatgatgctaaa
gagaagcttcagccttttgcaaatttgactagtgaagaaagctaccaaagtcgtgacttg
gaaaaggcctctcaacaagtagcaaagcatctgtatgatatcaaagttcaaccatcaact
ctgcttccaaaacagatcggtaatatgtacactgcatctctttatgctgcattggcatct
gtgatctacaacaagcatgacagtctggatggccagcgaattctcatgttttcttatggg
agtggattgacatccactatgttttcgttgagactacatgatggtcaacatccctttagc
ttaatgaacattgcttctgtgcttgatgtgacgacaaagcttgagtcaagacatgtgacc
tcacctgagaagtttattgagacattgaagctgatggagcaccgctatggagcaaaagat
tttgaaacaagcaaagataccagcttgttgccaccaggaacattctatcttacaaaagtt
gattcgatgtacaggaggttctatgacaagaaagccgccgagggaaaaatcaagggctgc
aacggcattgcaaacggtcactga

DBGET integrated database retrieval system